Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Artemisia vulgaris Artv1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Artemisia vulgaris (Mugwort)
Uniprot ID:
Q84ZX5
Molecular weight:
13.09 kDa

Original price was: €415.00.Current price is: €329.00.

100ug 21% OFF + 329 loyalty points
Ala25–His132
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Artemisia vulgaris Artv1 Protein, N-His

Product name ARO-P12699-100
Uniprot ID Q84ZX5
Origin species Artemisia vulgaris (Mugwort)
Expression system Prokaryotic expression
Raw Antigen Sequence AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
Molecular weight 13.09 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala25-His132
Aliases /Synonyms Major pollen allergen Art v 1, Defensin-like protein 1, Art v 1
Reference ARO-P12699
Note For research use only.
Molecular Constructor
Ala25–His132
Product name ARO-P12699-1MG
Uniprot ID Q84ZX5
Origin species Artemisia vulgaris (Mugwort)
Expression system Prokaryotic expression
Raw Antigen Sequence AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
Molecular weight 13.09 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala25-His132
Aliases /Synonyms Major pollen allergen Art v 1, Defensin-like protein 1, Art v 1
Reference ARO-P12699
Note For research use only.
Molecular Constructor
Ala25–His132
Product name ARO-P12699-50
Uniprot ID Q84ZX5
Origin species Artemisia vulgaris (Mugwort)
Expression system Prokaryotic expression
Raw Antigen Sequence AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
Molecular weight 13.09 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala25-His132
Aliases /Synonyms Major pollen allergen Art v 1, Defensin-like protein 1, Art v 1
Reference ARO-P12699
Note For research use only.
Molecular Constructor
Ala25–His132

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, allowing for the manipulation and expression of specific genes. One such recombinant protein is the Recombinant Artemisia vulgaris Artv1 Protein, which has gained attention for its potential therapeutic applications. In this article, we will explore the structure, activity, and potential applications of this protein.

Structure of Recombinant Artemisia vulgaris Artv1 Protein

The Recombinant Artemisia vulgaris Artv1 Protein is a 17.5 kDa protein that is composed of 158 amino acids. It is a member of the plant defensin family, which are small, cysteine-rich proteins that play a role in plant defense against pathogens. The protein has a three-dimensional structure consisting of a beta-sheet and an alpha-helix, which is stabilized by four disulfide bonds. This compact structure is essential for the protein’s stability and activity.

Activity of Recombinant Artemisia vulgaris Artv1 Protein

The Recombinant Artemisia vulgaris Artv1 Protein has been shown to have potent antimicrobial activity against a wide range of microorganisms, including bacteria, fungi, and viruses. This activity is due to the protein’s ability to disrupt the cell membrane of these pathogens, leading to their death. Additionally, the protein has been found to have anti-inflammatory and immunomodulatory properties, making it a potential candidate for treating inflammatory and autoimmune diseases.

Application of Recombinant Artemisia vulgaris Artv1 Protein

The potential applications of Recombinant Artemisia vulgaris Artv1 Protein are vast, and ongoing research is being conducted to explore its therapeutic potential. One of the most promising applications is in the field of infectious diseases. The protein’s antimicrobial activity makes it a potential candidate for developing new antibiotics to combat drug-resistant bacteria. It has also shown promising results in treating fungal infections, such as candidiasis and aspergillosis.

Another potential application of Recombinant Artemisia vulgaris Artv1 Protein is in the treatment of inflammatory and autoimmune diseases. Studies have shown that the protein can inhibit the production of inflammatory cytokines and modulate the immune response, making it a potential candidate for diseases such as rheumatoid arthritis, psoriasis, and multiple sclerosis.

Furthermore, the protein has also been studied for its potential in cancer treatment. It has been found to have cytotoxic effects on cancer cells, making it a potential candidate for developing new anticancer therapies. Additionally, the protein’s anti-inflammatory properties may also play a role in inhibiting tumor growth and metastasis.

Conclusion

The Recombinant Artemisia vulgaris Artv1 Protein is a promising protein with a compact structure and potent antimicrobial, anti-inflammatory, and immunomodulatory properties. Its potential applications in the fields of infectious diseases, inflammatory and autoimmune diseases, and cancer make it a valuable candidate for further research and development. With ongoing studies and advancements in genetic engineering techniques, this protein has the potential to revolutionize the treatment of various diseases.

Recombinant Artemisia vulgaris Artv1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Artemisia vulgaris Artv1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products