Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Pro-epidermal growth factor(EGF)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P01133
Molecular weight:
18.3kDa

Original price was: €228.00.Current price is: €182.00.

50ug 20% OFF + 182 loyalty points
His Met608–Gly751
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Pro-epidermal growth factor(EGF)

Product name Pro-epidermal Growth Factor proteins(EGF)
Uniprot ID P01133
Uniprot link https://www.uniprot.org/uniprot/P01133
Expression system Prokaryotic expression
Raw Antigen Sequence MAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNGG
Molecular weight 18.3kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met608-Gly751
Protein Accession P01133
Spec:Entrez GeneID 1950
Spec:NCBI Gene Aliases URG; HOMG4
Spec:SwissProtID Q52LZ6
NCBI Reference P01133
Aliases /Synonyms /
Reference PX-P4822
Note For research use only
Molecular Constructor
His Met608–Gly751
Product name Pro-epidermal Growth Factor proteins(EGF)
Uniprot ID P01133
Uniprot link https://www.uniprot.org/uniprot/P01133
Expression system Prokaryotic expression
Raw Antigen Sequence MAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNGG
Molecular weight 18.3kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met608-Gly751
Protein Accession P01133
Spec:Entrez GeneID 1950
Spec:NCBI Gene Aliases URG; HOMG4
Spec:SwissProtID Q52LZ6
NCBI Reference P01133
Aliases /Synonyms /
Reference PX-P4822
Note For research use only
Molecular Constructor
His Met608–Gly751
Product name PX-P4822-1MG
Uniprot ID P01133
Uniprot link https://www.uniprot.org/uniprot/P01133
Expression system Prokaryotic expression
Raw Antigen Sequence MAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNGG
Molecular weight 18.3kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met608-Gly751
Protein Accession P01133
Spec:Entrez GeneID 1950
Spec:NCBI Gene Aliases URG; HOMG4
Spec:SwissProtID Q52LZ6
NCBI Reference P01133
Aliases /Synonyms /
Reference PX-P4822
Note For research use only
Molecular Constructor
His Met608–Gly751

Pro-epidermal growth factor(EGF)

There are no reviews yet.

Be the first to review “Pro-epidermal growth factor(EGF)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products