Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Pintumomab Biosimilar – Anti-DPEP3 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €324.00.Current price is: €259.00.

50ug 20% OFF + 259 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Pintumomab Biosimilar - Anti-DPEP3 mAb - Research Grade

Product name Pintumomab Biosimilar - Anti-DPEP3 mAb - Research Grade
Uniprot ID Q9H4B8
Source 170, CAS: 339177-26-3
Species Mus musculus
Expression system XtenCHO
Raw Antigen Sequence MQPTGREGSRALSRRYLRRLLLLLLLLLLRQPVTRAETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRSSNASPYLVPGLVAAATIPTFTQWLC
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-DPEP3,Dipeptidase 3,
Reference PX-TA1922
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Pintumomab Biosimilar - Anti-DPEP3 mAb - Research Grade
Uniprot ID Q9H4B8
Source 170, CAS: 339177-26-3
Species Mus musculus
Expression system XtenCHO
Raw Antigen Sequence MQPTGREGSRALSRRYLRRLLLLLLLLLLRQPVTRAETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRSSNASPYLVPGLVAAATIPTFTQWLC
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-DPEP3,Dipeptidase 3,
Reference PX-TA1922
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1922-50
Uniprot ID Q9H4B8
Source 170, CAS: 339177-26-3
Species Mus musculus
Expression system XtenCHO
Raw Antigen Sequence MQPTGREGSRALSRRYLRRLLLLLLLLLLRQPVTRAETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRSSNASPYLVPGLVAAATIPTFTQWLC
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-DPEP3,Dipeptidase 3,
Reference PX-TA1922
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Pintumomab Biosimilar, also known as Anti-DPEP3 mAb, is a monoclonal antibody that has been developed as a biosimilar to the original therapeutic antibody. It is designed to target DPEP3, a cell surface protein that is overexpressed in certain types of cancer. Pintumomab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for its potential as a cancer treatment.

Structure

Pintumomab Biosimilar is a recombinant humanized monoclonal antibody, meaning that it is produced in a laboratory using genetic engineering techniques. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The antibody has a Y-shaped structure, with two antigen binding sites located at the tips of the Y. These binding sites are specific for the DPEP3 protein, allowing Pintumomab Biosimilar to selectively target cancer cells that overexpress DPEP3.

Activity

Pintumomab Biosimilar works by binding to the DPEP3 protein on the surface of cancer cells. This binding triggers a series of events that lead to the destruction of the cancer cells. Firstly, the binding of Pintumomab Biosimilar to DPEP3 activates the body’s immune system, specifically the complement system. This results in the formation of a membrane attack complex, which causes pores to form in the cancer cell membrane, leading to cell lysis and death. Additionally, Pintumomab Biosimilar can also induce antibody-dependent cellular cytotoxicity (ADCC), where immune cells such as natural killer cells are recruited to the site of the cancer cells and destroy them.

Application

Pintumomab Biosimilar is being developed as a potential treatment for various types of cancer, including colorectal, lung, breast, and ovarian cancers. These cancers have been found to overexpress DPEP3, making it a suitable therapeutic target for Pintumomab Biosimilar. The antibody is currently being evaluated in clinical trials to determine its safety and efficacy in treating these types of cancer.

Potential Advantages

As a biosimilar, Pintumomab Biosimilar offers several potential advantages over the original therapeutic antibody. Firstly, it is expected to have a lower cost, making it more accessible to patients. Additionally, being a recombinant humanized antibody, it is less likely to cause an immune response in patients, reducing the risk of adverse reactions. Furthermore, Pintumomab Biosimilar is produced using advanced technology, ensuring a consistent and high-quality product.

Conclusion

In summary, Pintumomab Biosimilar is a promising monoclonal antibody that has been developed as a biosimilar to the original therapeutic antibody. It has a specific structure that allows it to bind to the DPEP3 protein on cancer cells and induce their destruction through activation of the immune system. Pintumomab Biosimilar is currently being evaluated in clinical trials for its potential as a treatment for various types of cancer, and if successful, it could offer a more affordable and effective option for patients.

SDS-PAGE for Pintumomab Biosimilar - Anti-DPEP3 mAb - Research Grade

SDS-PAGE for Pintumomab Biosimilar - Anti-DPEP3 mAb - Research Grade

Pintumomab Biosimilar - Anti-DPEP3 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Pintumomab Biosimilar - Anti-DPEP3 mAb - Research Grade

There are no reviews yet.

Be the first to review “Pintumomab Biosimilar – Anti-DPEP3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products