Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Peroxisome proliferator-activated receptor alpha(PPARA)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q07869
Molecular weight:
31.6kDa

Original price was: €233.00.Current price is: €182.00.

50ug 22% OFF + 182 loyalty points
Ala201–Tyr468 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Peroxisome proliferator-activated receptor alpha(PPARA)

Product name Peroxisome proliferator-activated receptor alpha(PPARA)
Uniprot ID Q07869
Uniprot link https://www.uniprot.org/uniprot/Q07869
Expression system Prokaryotic expression
Raw Antigen Sequence ADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Molecular weight 31.6kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala201-Tyr468
Protein Accession Q07869
Spec:Entrez GeneID 5465
Spec:NCBI Gene Aliases PPAR; NR1C1; hPPAR; PPARalpha
Spec:SwissProtID Q16241
NCBI Reference Q07869
Aliases /Synonyms Nuclear receptor subfamily 1 group C member 1,NR1C1, PPAR
Reference PX-P4597
Note For research use only
Molecular Constructor
Ala201–Tyr468 His
Product name Peroxisome proliferator-activated receptor alpha(PPARA)
Uniprot ID Q07869
Uniprot link https://www.uniprot.org/uniprot/Q07869
Expression system Prokaryotic expression
Raw Antigen Sequence ADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Molecular weight 31.6kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala201-Tyr468
Protein Accession Q07869
Spec:Entrez GeneID 5465
Spec:NCBI Gene Aliases PPAR; NR1C1; hPPAR; PPARalpha
Spec:SwissProtID Q16241
NCBI Reference Q07869
Aliases /Synonyms Nuclear receptor subfamily 1 group C member 1,NR1C1, PPAR
Reference PX-P4597
Note For research use only
Molecular Constructor
Ala201–Tyr468 His
Product name PX-P4597-1MG
Uniprot ID Q07869
Uniprot link https://www.uniprot.org/uniprot/Q07869
Expression system Prokaryotic expression
Raw Antigen Sequence ADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Molecular weight 31.6kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala201-Tyr468
Protein Accession Q07869
Spec:Entrez GeneID 5465
Spec:NCBI Gene Aliases PPAR; NR1C1; hPPAR; PPARalpha
Spec:SwissProtID Q16241
NCBI Reference Q07869
Aliases /Synonyms Nuclear receptor subfamily 1 group C member 1,NR1C1, PPAR
Reference PX-P4597
Note For research use only
Molecular Constructor
Ala201–Tyr468 His

Peroxisome proliferator-activated receptor alpha(PPARA)

There are no reviews yet.

Be the first to review “Peroxisome proliferator-activated receptor alpha(PPARA)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products