Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade

  • PX-TA1115-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG2a-nd

Original price was: €196.00.Current price is: €140.00.

50ug 29% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Grade

Product name Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Grade
Uniprot ID P01911
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Oncolym,Iodine 131-ILym-1,Lym-1,Oncolym,HLA-DR10,anti-HLA-DR10
Reference PX-TA1115
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2a-nd
Clonality Monoclonal Antibody
Product name Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Grade
Uniprot ID P01911
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Oncolym,Iodine 131-ILym-1,Lym-1,Oncolym,HLA-DR10,anti-HLA-DR10
Reference PX-TA1115
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2a-nd
Clonality Monoclonal Antibody
Product name PX-TA1115-50
Uniprot ID P01911
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Oncolym,Iodine 131-ILym-1,Lym-1,Oncolym,HLA-DR10,anti-HLA-DR10
Reference PX-TA1115
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2a-nd
Clonality Monoclonal Antibody

Introduction

Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade is a monoclonal antibody (mAb) that specifically targets the human leukocyte antigen (HLA)-DR10 protein. This biosimilar is designed to mimic the activity of the original anti-HLA-DR10 mAb, with the potential to treat various types of cancer. In this article, we will discuss the structure, activity, and potential applications of Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade.

Structure of Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade

Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade is a recombinant humanized IgG1 monoclonal antibody. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of two constant domains (CL) and one variable domain (VL). The variable domains of the heavy and light chains together form the antigen-binding site, which specifically recognizes and binds to the HLA-DR10 protein.

Activity of Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade

The main activity of Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade is its ability to bind to and inhibit the function of the HLA-DR10 protein. HLA-DR10 is a cell surface receptor that is overexpressed in various types of cancer, including breast, lung, and colon cancer. It plays a critical role in tumor growth and progression by promoting immune evasion and suppressing anti-tumor immune responses. By targeting HLA-DR10, Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade can block its activity and potentially inhibit tumor growth.

In addition to its direct anti-

cancer activity, Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade also has an immunomodulatory effect. It can activate immune cells, such as T cells and natural killer (NK) cells, to recognize and attack cancer cells. This dual mechanism of action makes it a promising therapeutic candidate for cancer treatment.

Applications of Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade

Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade has potential applications in the treatment of various types of cancer. It can be used as a monotherapy or in combination with other anti- cancer therapies. Some potential applications of this biosimilar include:

1. Breast cancer: HLA-DR10 is overexpressed in approximately 70% of breast cancer cases. By targeting this protein, Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade has the potential to inhibit tumor growth and improve patient outcomes.

2. Lung cancer: HLA-DR10 is also overexpressed in lung cancer, particularly in non-small cell lung cancer (NSCLC). In preclinical studies, Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade has shown promising results in inhibiting tumor growth and improving survival rates.

3. Colon cancer: HLA-DR10 is highly expressed in colon cancer, and its expression is associated with poor prognosis. By targeting this protein, Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade may improve patient outcomes and potentially overcome resistance to other therapies.

4. Combination therapy: Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade can also be used in combination with other anti- cancer therapies, such as chemotherapy, targeted therapy, and immunotherapy. This combination approach has the potential to enhance the anti-tumor activity and improve patient outcomes.

Conclusion

In summary, Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade is a recombinant humanized monoclonal antibody that specifically targets the H

SEC-HPLC of Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Grade

SEC-HPLC of Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Grade

Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Grade

SDS-PAGE for Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Grade

Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Grade

There are no reviews yet.

Be the first to review “Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products