Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

N-acyl homoserine lactone hydrolase (SAMN04487767_102296)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
A0A1D3P3H1
Molecular weight:
29.20KDa

€329.00

100ug + 329 loyalty points
Met1–Ile250
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
N-acyl homoserine lactone hydrolase (SAMN04487767_102296)

N-acyl homoserine lactone hydrolase (SAMN04487767_102296)

Product name N-acyl homoserine lactone hydrolase (SAMN04487767_102296)
Uniprot ID A0A1D3P3H1
Uniprot link https://www.uniprot.org/uniprot/A0A1D3P3H1
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGMTVKKLYFVPAGRCMLDHSSVNSTLTPGELLDLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPEDLLYIISSHLHFDHAGGNGAFINTPIIVQRAEYEAAQHSEEYLKECILPNLNYKIIEGDYEVVSGVQLLHTPGHTPGHQSLLIETEKSGSVLLTIDASYTKENFEEEVPFAGFDPELALSSIKRLKEVVIKEKPIVFFGHDIEQEKGCKVFPEYI
Molecular weight 29.20KDa
Purity estimated 90%
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ile250
Aliases /Synonyms N-acyl homoserine lactonase/N-acyl homoserine lactone hydrolase
Reference PX-P4359
Note For research use only
Molecular Constructor
Met1–Ile250
Product name N-acyl homoserine lactone hydrolase (SAMN04487767_102296)
Uniprot ID A0A1D3P3H1
Uniprot link https://www.uniprot.org/uniprot/A0A1D3P3H1
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGMTVKKLYFVPAGRCMLDHSSVNSTLTPGELLDLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPEDLLYIISSHLHFDHAGGNGAFINTPIIVQRAEYEAAQHSEEYLKECILPNLNYKIIEGDYEVVSGVQLLHTPGHTPGHQSLLIETEKSGSVLLTIDASYTKENFEEEVPFAGFDPELALSSIKRLKEVVIKEKPIVFFGHDIEQEKGCKVFPEYI
Molecular weight 29.20KDa
Purity estimated 90%
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ile250
Aliases /Synonyms N-acyl homoserine lactonase/N-acyl homoserine lactone hydrolase
Reference PX-P4359
Note For research use only
Molecular Constructor
Met1–Ile250

There are no reviews yet.

Be the first to review “N-acyl homoserine lactone hydrolase (SAMN04487767_102296)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products