Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Bifidobacterium longum Amidase Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Bifidobacterium longum
Molecular weight:
46.76kDa

329.00

100ug + 329 loyalty points
Partial Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Bifidobacterium longum Amidase Recombinant Protein

Product name Bifidobacterium longum Amidase Recombinant Protein
Uniprot link https://www.uniprot.org/uniprot/
Origin species Bifidobacterium longum
Expression system Prokaryotic expression
Raw Antigen Sequence MGCVGGLAFSSAQPAQADTYSDLINAQNQHAASVQREAELKQQLAGASQDLANKVLELDDLTNNKIVAAQAKVTQANEDAATAQDEADAASGRLSAAQKDKETLEEQIKQTGKDYDDAHAAVAQLARDEMHGSNASDVMSVVTGATSTQDFVNSMQSRDALSRNEANAASSAATSLSTSKNRGERLAAIEKQIAVLKTQADEKAASAQTAAETAQSERDALDKLRQEGEARRDELSSMIDSLDSQSAKQAAQTVLIASQVDSYNRQFQKEQQDAANRVDTGNQGGTPSTPVTPAPAPAPAPAPAPAPAPAPSVGGQGTSNGDYGNAYATGQCTYWAYERRRQMGIGTPSYLGNGGDWWRNAPSYGLRVDHNPQVGAALSFLPGQDGADGTWGHVAVVEAVYGDGTFQISEMNVGGLWMMNYRTLTNLGQYWFVHGSHHHHHH
Molecular weight 46.76kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference WP_032737268.1
Reference PX-P4064
Note For research use only
Molecular Constructor
Partial Yes
Product name Bifidobacterium longum Amidase Recombinant Protein
Uniprot link https://www.uniprot.org/uniprot/
Origin species Bifidobacterium longum
Expression system Prokaryotic expression
Raw Antigen Sequence MGCVGGLAFSSAQPAQADTYSDLINAQNQHAASVQREAELKQQLAGASQDLANKVLELDDLTNNKIVAAQAKVTQANEDAATAQDEADAASGRLSAAQKDKETLEEQIKQTGKDYDDAHAAVAQLARDEMHGSNASDVMSVVTGATSTQDFVNSMQSRDALSRNEANAASSAATSLSTSKNRGERLAAIEKQIAVLKTQADEKAASAQTAAETAQSERDALDKLRQEGEARRDELSSMIDSLDSQSAKQAAQTVLIASQVDSYNRQFQKEQQDAANRVDTGNQGGTPSTPVTPAPAPAPAPAPAPAPAPAPSVGGQGTSNGDYGNAYATGQCTYWAYERRRQMGIGTPSYLGNGGDWWRNAPSYGLRVDHNPQVGAALSFLPGQDGADGTWGHVAVVEAVYGDGTFQISEMNVGGLWMMNYRTLTNLGQYWFVHGSHHHHHH
Molecular weight 46.76kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference WP_032737268.1
Reference PX-P4064
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Bifidobacterium longum Amidase Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products