Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Myeloid cell surface antigen CD33(CD33)

Host species:
Mammalian cells
Uniprot ID:
P20138
Molecular weight:
29.6kDa

Original price was: €263.00.Current price is: €210.00.

50ug 20% OFF + 210 loyalty points
Met1–His259 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Myeloid cell surface antigen CD33(CD33)

Product name Myeloid cell surface antigen CD33(CD33)
Uniprot ID P20138
Uniprot link https://www.uniprot.org/uniprot/P20138
Expression system Eukaryotic expression
Raw Antigen Sequence MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
Molecular weight 29.6kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-His259
Protein Accession P20138
Spec:Entrez GeneID 945
Spec:NCBI Gene Aliases p67; SIGLEC3; SIGLEC-3
Spec:SwissProtID Q8TD24
NCBI Reference P20138
Aliases /Synonyms Sialic acid-binding Ig-like lectin 3,Siglec-3,gp67,CD_antigen: CD33,SIGLEC3
Reference PX-P4861
Note For research use only
Molecular Constructor
Met1–His259 His
Product name Myeloid cell surface antigen CD33(CD33)
Uniprot ID P20138
Uniprot link https://www.uniprot.org/uniprot/P20138
Expression system Eukaryotic expression
Raw Antigen Sequence MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
Molecular weight 29.6kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-His259
Protein Accession P20138
Spec:Entrez GeneID 945
Spec:NCBI Gene Aliases p67; SIGLEC3; SIGLEC-3
Spec:SwissProtID Q8TD24
NCBI Reference P20138
Aliases /Synonyms Sialic acid-binding Ig-like lectin 3,Siglec-3,gp67,CD_antigen: CD33,SIGLEC3
Reference PX-P4861
Note For research use only
Molecular Constructor
Met1–His259 His
Product name PX-P4861-1MG
Uniprot ID P20138
Uniprot link https://www.uniprot.org/uniprot/P20138
Expression system Eukaryotic expression
Raw Antigen Sequence MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
Molecular weight 29.6kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-His259
Protein Accession P20138
Spec:Entrez GeneID 945
Spec:NCBI Gene Aliases p67; SIGLEC3; SIGLEC-3
Spec:SwissProtID Q8TD24
NCBI Reference P20138
Aliases /Synonyms Sialic acid-binding Ig-like lectin 3,Siglec-3,gp67,CD_antigen: CD33,SIGLEC3
Reference PX-P4861
Note For research use only
Molecular Constructor
Met1–His259 His

Myeloid cell surface antigen CD33(CD33)

There are no reviews yet.

Be the first to review “Myeloid cell surface antigen CD33(CD33)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products