Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse MIOX Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9QXN5
Molecular weight:
35.33 kDa

Original price was: €255.00.Current price is: €228.00.

50ug 11% OFF + 228 loyalty points
His Met1–Trp285
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse MIOX Recombinant Protein, N-His

Product name ARO-P21285-100
Uniprot ID Q9QXN5
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MKVDVGPDPSLVYRPDVDPEMAKSKDSFRNYTSGPLLDRVFTTYKLMHTHQTVDFVSRKRIQYGSFSYKKMTIMEAVGMLDDLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKIMALWGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLENVLMSWGHDEYLYQMMKFNKFSLPSEAFYMIRFHSFYPWHTGGDYRQLCSQQDLDMLPWVQEFNKFDLYTKCPDLPDVESLRPYYQGLIDKYCPGTLSW
Molecular weight 35.33 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Trp285
Aliases /Synonyms Aldehyde reductase-like 6, Aldrl6, EC:1.13.99.1, Inositol oxygenase, MI oxygenase, Miox, Myo-inositol oxygenase, Renal-specific oxidoreductase, Rsor
Reference ARO-P21285
Note For research use only.
Molecular Constructor
His Met1–Trp285
Product name ARO-P21285-1MG
Uniprot ID Q9QXN5
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MKVDVGPDPSLVYRPDVDPEMAKSKDSFRNYTSGPLLDRVFTTYKLMHTHQTVDFVSRKRIQYGSFSYKKMTIMEAVGMLDDLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKIMALWGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLENVLMSWGHDEYLYQMMKFNKFSLPSEAFYMIRFHSFYPWHTGGDYRQLCSQQDLDMLPWVQEFNKFDLYTKCPDLPDVESLRPYYQGLIDKYCPGTLSW
Molecular weight 35.33 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Trp285
Aliases /Synonyms Aldehyde reductase-like 6, Aldrl6, EC:1.13.99.1, Inositol oxygenase, MI oxygenase, Miox, Myo-inositol oxygenase, Renal-specific oxidoreductase, Rsor
Reference ARO-P21285
Note For research use only.
Molecular Constructor
His Met1–Trp285
Product name ARO-P21285-50
Uniprot ID Q9QXN5
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MKVDVGPDPSLVYRPDVDPEMAKSKDSFRNYTSGPLLDRVFTTYKLMHTHQTVDFVSRKRIQYGSFSYKKMTIMEAVGMLDDLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKIMALWGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLENVLMSWGHDEYLYQMMKFNKFSLPSEAFYMIRFHSFYPWHTGGDYRQLCSQQDLDMLPWVQEFNKFDLYTKCPDLPDVESLRPYYQGLIDKYCPGTLSW
Molecular weight 35.33 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Trp285
Aliases /Synonyms Aldehyde reductase-like 6, Aldrl6, EC:1.13.99.1, Inositol oxygenase, MI oxygenase, Miox, Myo-inositol oxygenase, Renal-specific oxidoreductase, Rsor
Reference ARO-P21285
Note For research use only.
Molecular Constructor
His Met1–Trp285

Mouse MIOX Recombinant Protein, N-His

Biological Function:

Mouse MIOX Recombinant Protein, N-His is a high-quality recombinant protein that plays a crucial role in the regulation of oxidative stress and cellular metabolism. It is a member of the myo-inositol oxygenase (MIOX) family, which catalyzes the conversion of myo-inositol into D-glucuronic acid, an essential component of the pentose phosphate pathway. This process is critical for maintaining cellular redox balance and protecting cells from oxidative damage.

Main Applications:

Mouse MIOX Recombinant Protein, N-His is widely used in various biotech applications, including drug discovery, cell signaling studies, and biochemical assays. Its ability to regulate oxidative stress makes it a valuable tool for studying diseases related to oxidative damage, such as cancer, diabetes, and neurodegenerative disorders. Additionally, it has been used in the production of recombinant antibodies and in the development of therapeutics targeting oxidative stress.

Experimental Use Cases:

1. Drug Discovery: Mouse MIOX Recombinant Protein, N-His has been used in drug discovery studies to investigate its potential as a therapeutic target for oxidative stress-related diseases. Its role in regulating cellular redox balance makes it a promising candidate for developing new treatments.

2. Cell Signaling Studies: The activity of Mouse MIOX Recombinant Protein, N-His can be modulated by various signaling pathways, making it a valuable tool for studying the mechanisms of oxidative stress and its impact on cellular metabolism.

3. Biochemical Assays: Mouse MIOX Recombinant Protein, N-His is commonly used in biochemical assays to measure its enzymatic activity and evaluate its potential as a biomarker for oxidative stress-related diseases.

In conclusion, Mouse MIOX Recombinant Protein, N-His is a highly versatile and valuable tool for studying oxidative stress and its impact on cellular metabolism. Its role in regulating redox balance and its potential as a therapeutic target make it a crucial component in biotech research and drug discovery. With its high purity and activity, it is the ideal choice for any experiment or assay requiring a reliable and efficient MIOX protein. Order now and take your research to the next level with Mouse MIOX Recombinant Protein, N-His.

There are no reviews yet.

Be the first to review “Mouse MIOX Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products