Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse CD47 recombinant protein

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
Q61735-2
Molecular weight:
18.88 kDa

Original price was: €349.00.Current price is: €277.00.

50ug 21% OFF + 277 loyalty points
Met1–Ile162 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Mouse CD47 recombinant protein
Mouse CD47 recombinant protein

Mouse CD47 recombinant protein

Product name PX-P6437-100
Uniprot ID Q61735-2
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MWPLAAALLLGSCCCGSAQLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSPNEKI
Molecular weight 18.88 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ile162
Aliases /Synonyms Integrin-associated protein, IAP, CD47, Cd47Leukocyte surface antigen CD47,
Reference PX-P6437
Molecular Constructor
Met1–Ile162 His
Product name PX-P6437-1MG
Uniprot ID Q61735-2
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MWPLAAALLLGSCCCGSAQLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSPNEKI
Molecular weight 18.88 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ile162
Aliases /Synonyms Integrin-associated protein, IAP, CD47, Cd47Leukocyte surface antigen CD47,
Reference PX-P6437
Molecular Constructor
Met1–Ile162 His
Product name PX-P6437-50
Uniprot ID Q61735-2
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MWPLAAALLLGSCCCGSAQLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSPNEKI
Molecular weight 18.88 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ile162
Aliases /Synonyms Integrin-associated protein, IAP, CD47, Cd47Leukocyte surface antigen CD47,
Reference PX-P6437
Molecular Constructor
Met1–Ile162 His

SDS-PAGE for Mouse CD47 recombinant protein

SDS-PAGE for Mouse CD47 recombinant protein

Mouse CD47 recombinant protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Mouse CD47 recombinant protein

There are no reviews yet.

Be the first to review “Mouse CD47 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products