Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse CD32 recombinant protein

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
P08101
Molecular weight:
23.21 kDa

Original price was: €324.00.Current price is: €277.00.

50ug 15% OFF + 277 loyalty points
Thr30–Arg207 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Mouse CD32 recombinant protein

Mouse CD32 recombinant protein

Product name PX-P6394-100
Uniprot ID P08101
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSR
Molecular weight 23.21 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Thr30-Arg207
Aliases /Synonyms Fc gamma receptor IIB, Fc-gamma RII, Fc-gamma-RIIB, FcRII, IgG Fc receptor II beta, Lymphocyte antigen 17, Ly-17, CD32, Fcgr2, Fcgr2b, Ly-17Low affinity immunoglobulin gamma Fc region receptor II,
Reference PX-P6394
Molecular Constructor
Thr30–Arg207 His
Product name PX-P6394-1MG
Uniprot ID P08101
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSR
Molecular weight 23.21 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Thr30-Arg207
Aliases /Synonyms Fc gamma receptor IIB, Fc-gamma RII, Fc-gamma-RIIB, FcRII, IgG Fc receptor II beta, Lymphocyte antigen 17, Ly-17, CD32, Fcgr2, Fcgr2b, Ly-17Low affinity immunoglobulin gamma Fc region receptor II,
Reference PX-P6394
Molecular Constructor
Thr30–Arg207 His
Product name PX-P6394-50
Uniprot ID P08101
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSR
Molecular weight 23.21 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Thr30-Arg207
Aliases /Synonyms Fc gamma receptor IIB, Fc-gamma RII, Fc-gamma-RIIB, FcRII, IgG Fc receptor II beta, Lymphocyte antigen 17, Ly-17, CD32, Fcgr2, Fcgr2b, Ly-17Low affinity immunoglobulin gamma Fc region receptor II,
Reference PX-P6394
Molecular Constructor
Thr30–Arg207 His

Mouse CD32 recombinant protein

There are no reviews yet.

Be the first to review “Mouse CD32 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products