Brand: ProteoGenix

Mouse CD11a/ITGAL Recombinant Protein, C-His

+ 325 loyalty points

Lys151–Thr335 His

Product name	Mouse CD11a/ITGAL Recombinant Protein, C-His
Uniprot ID	P24063
Origin species	Mouse
Expression system	Eukaryotic expression
Raw Antigen Sequence	KVDLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDLQRRIYAIEGT
Molecular weight	24.06 kDa
Protein delivered with Tag?	C-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Lys151-Thr335
Aliases /Synonyms	CD11 antigen-like family member A, CD11A, CD11a, ITGAL, Integrin alpha-L, LFA-1A, Leukocyte adhesion glycoprotein LFA-1 alpha chain, Leukocyte function-associated molecule 1 alpha chain
Reference	ARO-P19191
Note	For research use only.
Molecular Constructor	Lys151–Thr335 His

There are no reviews yet.

Be the first to review “Mouse CD11a/ITGAL Recombinant Protein, C-His”

Related products