Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse CD11a/ITGAL Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
P24063
Molecular weight:
24.06 kDa

+ 325 loyalty points
Lys151–Thr335 His

This product is currently out of stock and unavailable.

  • Out of Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse CD11a/ITGAL Recombinant Protein, C-His

Product name Mouse CD11a/ITGAL Recombinant Protein, C-His
Uniprot ID P24063
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence KVDLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDLQRRIYAIEGT
Molecular weight 24.06 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Lys151-Thr335
Aliases /Synonyms CD11 antigen-like family member A, CD11A, CD11a, ITGAL, Integrin alpha-L, LFA-1A, Leukocyte adhesion glycoprotein LFA-1 alpha chain, Leukocyte function-associated molecule 1 alpha chain
Reference ARO-P19191
Note For research use only.
Molecular Constructor
Lys151–Thr335 His

There are no reviews yet.

Be the first to review “Mouse CD11a/ITGAL Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products