Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse CD107a/LAMP1 Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
P11438

Original price was: €296.00.Current price is: €228.00.

50ug 23% OFF + 228 loyalty points
Ala22–Met371 Fc
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Mouse CD107a/LAMP1 Recombinant Protein, C-Fc

Mouse CD107a/LAMP1 Recombinant Protein, C-Fc

Product name PX-P7029-100
Uniprot ID P11438
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence ASALFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNNM
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala22-Met371
Aliases /Synonyms Lysosome-associated membrane glycoprotein 1, LAMP-1, Lysosome-associated membrane protein 1, CD107 antigen-like family member A, CD107a, LAMP1
Reference PX-P7029
Note For research use only.
Molecular Constructor
Ala22–Met371 Fc
Product name PX-P7029-1MG
Uniprot ID P11438
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence ASALFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNNM
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala22-Met371
Aliases /Synonyms Lysosome-associated membrane glycoprotein 1, LAMP-1, Lysosome-associated membrane protein 1, CD107 antigen-like family member A, CD107a, LAMP1
Reference PX-P7029
Note For research use only.
Molecular Constructor
Ala22–Met371 Fc
Product name PX-P7029-50
Uniprot ID P11438
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence ASALFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNNM
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala22-Met371
Aliases /Synonyms Lysosome-associated membrane glycoprotein 1, LAMP-1, Lysosome-associated membrane protein 1, CD107 antigen-like family member A, CD107a, LAMP1
Reference PX-P7029
Note For research use only.
Molecular Constructor
Ala22–Met371 Fc

SDS-PAGE for Mouse CD107a/LAMP1 Recombinant Protein, C-Fc

SDS-PAGE for Mouse CD107a/LAMP1 Recombinant Protein, C-Fc

Mouse CD107a/LAMP1 Recombinant Protein, C-Fc, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Mouse CD107a/LAMP1 Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products