Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mannose-binding protein C

Host species:
Mammalian cells
Uniprot ID:
P08661
Molecular weight:
27.27kDa

Original price was: €239.00.Current price is: €210.00.

50ug 12% OFF + 210 loyalty points
Glu19–Asp244 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mannose-binding protein C

Product name Mannose-binding protein C
Uniprot ID P08661
Uniprot link https://www.uniprot.org/uniprot/P08661
Expression system Eukaryotic expression
Raw Antigen Sequence ETLTEGAQSSCPVIACSSPGLNGFPGKDGHDGAKGEKGEPGQGLRGLQGPPGKVGPAGPPGNPGSKGATGPKGDRGESVEFDTTNIDLEIAALRSELRAMRKWVLLSMSENVGKKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFLGITDQRTENVFEDLTGNRVRYTNWNEGEPNNVGSGENCVVLLTNGKWNDVPCSDSFLVVCEFSD
Molecular weight 27.27kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu19-Asp244
Protein Accession P08661
Spec:Entrez GeneID 64668
Spec:NCBI Gene Aliases Ab2-001; Ab2-011
NCBI Reference P08661
Aliases /Synonyms Mbl2
Reference PX-P4455
Note For research use only
Molecular Constructor
Glu19–Asp244 His
Product name Mannose-binding protein C
Uniprot ID P08661
Uniprot link https://www.uniprot.org/uniprot/P08661
Expression system Eukaryotic expression
Raw Antigen Sequence ETLTEGAQSSCPVIACSSPGLNGFPGKDGHDGAKGEKGEPGQGLRGLQGPPGKVGPAGPPGNPGSKGATGPKGDRGESVEFDTTNIDLEIAALRSELRAMRKWVLLSMSENVGKKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFLGITDQRTENVFEDLTGNRVRYTNWNEGEPNNVGSGENCVVLLTNGKWNDVPCSDSFLVVCEFSD
Molecular weight 27.27kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu19-Asp244
Protein Accession P08661
Spec:Entrez GeneID 64668
Spec:NCBI Gene Aliases Ab2-001; Ab2-011
NCBI Reference P08661
Aliases /Synonyms Mbl2
Reference PX-P4455
Note For research use only
Molecular Constructor
Glu19–Asp244 His
Product name PX-P4455-1MG
Uniprot ID P08661
Uniprot link https://www.uniprot.org/uniprot/P08661
Expression system Eukaryotic expression
Raw Antigen Sequence ETLTEGAQSSCPVIACSSPGLNGFPGKDGHDGAKGEKGEPGQGLRGLQGPPGKVGPAGPPGNPGSKGATGPKGDRGESVEFDTTNIDLEIAALRSELRAMRKWVLLSMSENVGKKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFLGITDQRTENVFEDLTGNRVRYTNWNEGEPNNVGSGENCVVLLTNGKWNDVPCSDSFLVVCEFSD
Molecular weight 27.27kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu19-Asp244
Protein Accession P08661
Spec:Entrez GeneID 64668
Spec:NCBI Gene Aliases Ab2-001; Ab2-011
NCBI Reference P08661
Aliases /Synonyms Mbl2
Reference PX-P4455
Note For research use only
Molecular Constructor
Glu19–Asp244 His

Mannose-binding protein C

There are no reviews yet.

Be the first to review “Mannose-binding protein C”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products