Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Leronlimab Biosimilar – Anti-CCR5, CD195 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €168.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Leronlimab Biosimilar - Anti-CCR5, CD195 mAb - Research Grade

Product name Leronlimab Biosimilar - Anti-CCR5, CD195 mAb - Research Grade
Uniprot ID P51681
Source CAS 674782-26-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Leronlimab,HuPRO-140,PA-14,PRO-140,CCR5, CD195,anti-CCR5, CD195
Reference PX-TA1511
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Leronlimab Biosimilar - Anti-CCR5, CD195 mAb - Research Grade
Uniprot ID P51681
Source CAS 674782-26-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Leronlimab,HuPRO-140,PA-14,PRO-140,CCR5, CD195,anti-CCR5, CD195
Reference PX-TA1511
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1511-50
Uniprot ID P51681
Source CAS 674782-26-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Leronlimab,HuPRO-140,PA-14,PRO-140,CCR5, CD195,anti-CCR5, CD195
Reference PX-TA1511
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction to Leronlimab Biosimilar: Anti-CCR5, CD195 mAb

Leronlimab Biosimilar is a monoclonal antibody (mAb) that targets the C-C chemokine receptor type 5 (CCR5), also known as CD195. This biosimilar is a research grade version of the original Leronlimab, which has been approved by the FDA for the treatment of HIV/AIDS. The biosimilar version is currently in development for various therapeutic applications and has shown promising results in preclinical studies. In this article, we will explore the structure, activity, and potential applications of Leronlimab Biosimilar.

Structure of Leronlimab Biosimilar

Leronlimab Biosimilar is a recombinant humanized IgG4 monoclonal antibody that is produced using Chinese hamster ovary (CHO) cells. It has a molecular weight of approximately 148 kDa and consists of two heavy chains and two light chains. The heavy chains are composed of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains contain two constant domains (CL and CL2) and one variable domain (VL). The variable domains are responsible for binding to the target antigen, CCR5.

Activity of Leronlimab Biosimilar

Leronlimab Biosimilar works by binding to the CCR5 receptor on the surface of immune cells, specifically T-cells and macrophages. This receptor is a co-receptor for the human immunodeficiency virus (HIV), which uses it to enter and infect immune cells. By binding to CCR5, Leronlimab Biosimilar blocks the entry of HIV into the cells, preventing infection. This mechanism of action is similar to the original Leronlimab and has been shown to be effective in clinical trials for the treatment of HIV.

In addition to its activity against HIV, Leronlimab Biosimilar has also been found to have anti-inflammatory properties. CCR5 is not only a receptor for HIV, but it is also involved in the recruitment of immune cells to sites of inflammation. By blocking CCR5, Leronlimab Biosimilar can reduce the influx of immune cells and decrease inflammation in various disease conditions.

Potential Applications of Leronlimab Biosimilar

Leronlimab Biosimilar has the potential to be used in various therapeutic applications due to its ability to block CCR5 and modulate immune responses. Some of the potential applications include:

HIV/AIDS Treatment As mentioned earlier, the original Leronlimab has been approved by the FDA for the treatment of HIV/AIDS. The biosimilar version is currently in development and has shown promising results in preclinical studies. It is expected to have a similar efficacy and safety profile as the original drug, making it a potential alternative for patients who are unable to tolerate or have developed resistance to other HIV medications.

Inflammatory Diseases

The anti-inflammatory properties of Leronlimab Biosimilar make it a potential candidate for the treatment of various inflammatory diseases, such as rheumatoid arthritis, multiple sclerosis, and Crohn’s disease. In a preclinical study, Leronlimab Biosimilar was found to reduce inflammation and improve symptoms in a mouse model of rheumatoid arthritis. Further clinical trials are needed to evaluate its efficacy and safety in humans.

Cancer Treatment

CCR5 has been shown to play a role in the growth and spread of certain types of cancer, such as breast and prostate cancer. Leronlimab Biosimilar has the potential to inhibit the growth and metastasis of these cancers by blocking CCR5. It has also been found to enhance the effectiveness of chemotherapy in preclinical studies. Clinical trials are currently underway to evaluate its potential as a cancer treatment.

Organ Transplantation

Organ transplantation often requires the use of immunosuppressive drugs to prevent rejection of the transplanted organ. However, these drugs can increase

SDS-PAGE for Leronlimab Biosimilar - Anti-CCR5; CD195 mAb - Research Grade

SDS-PAGE for Leronlimab Biosimilar - Anti-CCR5; CD195 mAb - Research Grade

Leronlimab Biosimilar - Anti-CCR5; CD195 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Leronlimab Biosimilar - Anti-CCR5, CD195 mAb - Research Grade

There are no reviews yet.

Be the first to review “Leronlimab Biosimilar – Anti-CCR5, CD195 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products