Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Landogrozumab Biosimilar – Anti-MSTN, GDF8 mAb – Research Grade

  • PX-TA1403-50
  • Validated FC
Isotype:
IgG4, Kappa

Original price was: €188.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Landogrozumab Biosimilar - Anti-MSTN, GDF8 mAb - Research Grade

Product name Landogrozumab Biosimilar - Anti-MSTN, GDF8 mAb - Research Grade
Uniprot ID O14793
Source CAS 1391726-30-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Landogrozumab,LY-2495655,MSTN, GDF8,anti-MSTN, GDF8
Reference PX-TA1403
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Landogrozumab Biosimilar - Anti-MSTN, GDF8 mAb - Research Grade
Uniprot ID O14793
Source CAS 1391726-30-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Landogrozumab,LY-2495655,MSTN, GDF8,anti-MSTN, GDF8
Reference PX-TA1403
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1403-50
Uniprot ID O14793
Source CAS 1391726-30-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Landogrozumab,LY-2495655,MSTN, GDF8,anti-MSTN, GDF8
Reference PX-TA1403
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa

General information on Anti-MSTN/GDF8[Homo sapiens] (Landogrozumab) Monoclonal Antibody

Landogrozumab has been investigated for the treatment of Advanced Cancer, Muscular Atrophy, and Pancreatic Cancer.

SDS-PAGE for Landogrozumab Biosimilar - Anti-MSTN, GDF8 mAb

SDS-PAGE for Landogrozumab Biosimilar - Anti-MSTN, GDF8 mAb

Landogrozumab Biosimilar - Anti-MSTN, GDF8 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Landogrozumab Biosimilar - Anti-MSTN; GDF8 mAb - Research Grade

Flow Cytometry results for Landogrozumab Biosimilar - Anti-MSTN; GDF8 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Landogrozumab Biosimilar - Anti-MSTN; GDF8 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Landogrozumab Biosimilar - Anti-MSTN, GDF8 mAb - Research Grade

There are no reviews yet.

Be the first to review “Landogrozumab Biosimilar – Anti-MSTN, GDF8 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products