Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Kelch-like ECH-associated protein 1(KEAP1) |
---|---|
Uniprot ID | Q14145 |
Uniprot link | https://www.uniprot.org/uniprot/Q14145 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | AAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVRCESEVFHACI |
Molecular weight | 18.07 kDa |
Protein delivered with Tag? | N-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH 7.5, 0.02% SKL |
Delivery condition | Dry Ice |
Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Ala90-IIe250 |
Protein Accession | Q14145 |
Spec:Entrez GeneID | 9817 |
Spec:NCBI Gene Aliases | INrf2; KLHL19 |
Spec:SwissProtID | Q9BPY9 |
NCBI Reference | Q14145 |
Aliases /Synonyms | Cytosolic inhibitor of Nrf2; INrf2;Kelch-like protein 19 |
Reference | PX-P4789 |
Note | For research use only. |
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.