Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001)

  • ARO-A13372-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: €353.00.Current price is: €256.00.

50ug 27% OFF + 256 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Flow Cytometry results for InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001)
InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001) binds to Recombinant Human IFNA2/IFN-alpha-2 Protein, N-His in ELISA Assay

InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001)

Product name ARO-A13372-100
Uniprot ID P01563
Raw Antigen Sequence MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IFNA2, Interferon alpha-2, IFN-alpha-2, Interferon alpha-A, LeIF A, IFN-Alpha, IFNA2A, IFNA2B, IFNA2C, Interferon alpha-1/13, IFN-alpha-1/13, Interferon alpha-D, LeIF D, IFNA1, IFNA13, IFN-α4, IFN-α5, IFN-α6, IFN-α7, IFN-α8, IFN-αl0, IFN-α14, IFN-α16, IFN-α17, IFN-α21
Reference ARO-A13372
Clonality Monoclonal Antibody
Protein Name IFNA2
Product name ARO-A13372-1MG
Uniprot ID P01563
Raw Antigen Sequence MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IFNA2, Interferon alpha-2, IFN-alpha-2, Interferon alpha-A, LeIF A, IFN-Alpha, IFNA2A, IFNA2B, IFNA2C, Interferon alpha-1/13, IFN-alpha-1/13, Interferon alpha-D, LeIF D, IFNA1, IFNA13, IFN-α4, IFN-α5, IFN-α6, IFN-α7, IFN-α8, IFN-αl0, IFN-α14, IFN-α16, IFN-α17, IFN-α21
Reference ARO-A13372
Clonality Monoclonal Antibody
Protein Name IFNA2
Product name ARO-A13372-50
Uniprot ID P01563
Raw Antigen Sequence MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IFNA2, Interferon alpha-2, IFN-alpha-2, Interferon alpha-A, LeIF A, IFN-Alpha, IFNA2A, IFNA2B, IFNA2C, Interferon alpha-1/13, IFN-alpha-1/13, Interferon alpha-D, LeIF D, IFNA1, IFNA13, IFN-α4, IFN-α5, IFN-α6, IFN-α7, IFN-α8, IFN-αl0, IFN-α14, IFN-α16, IFN-α17, IFN-α21
Reference ARO-A13372
Clonality Monoclonal Antibody
Protein Name IFNA2

Flow Cytometry results for InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001)

Flow Cytometry results for InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001)

Target Cells were stained with an irrelevant antibody or InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001) binds to Recombinant Human IFNA2/IFN-alpha-2 Protein, N-His in ELISA Assay

InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001) binds to Recombinant Human IFNA2/IFN-alpha-2 Protein, N-His in ELISA Assay

Recombinant Human IFNA2/IFN-alpha-2 Protein, N-His(cat. No.ARO-P14545) at 0.5µg/mL (100µL/well) can bind InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001) in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human IFN α2/IFNA2 (Iv0001)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products