Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

InVivoMAb Anti-Human HBEGF (Iv0076)

  • ARO-A13298-50
  • Validated FC
Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: €325.00.Current price is: €256.00.

50ug 21% OFF + 256 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

InVivoMAb Anti-Human HBEGF (Iv0076)

Product name ARO-A13298-100
Uniprot ID Q99075
Raw Antigen Sequence MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-DTR, DT-R, DTS, HEGFL, HB-EGF, HBEGF, Proheparin-binding EGF-like growth factor, Diphtheria toxin receptor
Reference ARO-A13298
Clonality Monoclonal Antibody
Protein Name DTR
Product name ARO-A13298-1MG
Uniprot ID Q99075
Raw Antigen Sequence MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-DTR, DT-R, DTS, HEGFL, HB-EGF, HBEGF, Proheparin-binding EGF-like growth factor, Diphtheria toxin receptor
Reference ARO-A13298
Clonality Monoclonal Antibody
Protein Name DTR
Product name ARO-A13298-50
Uniprot ID Q99075
Raw Antigen Sequence MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-DTR, DT-R, DTS, HEGFL, HB-EGF, HBEGF, Proheparin-binding EGF-like growth factor, Diphtheria toxin receptor
Reference ARO-A13298
Clonality Monoclonal Antibody
Protein Name DTR

Flow Cytometry results for InVivoMAb Anti-Human HBEGF (Iv0076)

Flow Cytometry results for InVivoMAb Anti-Human HBEGF (Iv0076)

Flow-cytometry using anti-human HBEGF antibody.PC-3 cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human HBEGF antibody monoclonal antibody (Catalog # ARO-A13298 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-human antibody (Catalog # PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for InVivoMAb Anti-Human HBEGF (Iv0076)

SDS-PAGE for InVivoMAb Anti-Human HBEGF (Iv0076)

InVivoMAb Anti-Human HBEGF (Iv0076), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for InVivoMAb Anti-Human HBEGF (Iv0076)

Flow Cytometry results for InVivoMAb Anti-Human HBEGF (Iv0076)

Flow-cytometry using anti-human HBEGF antibody.HBEGF Transfected SF9 cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human HBEGF antibody monoclonal antibody (Catalog # ARO-A13298 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-human antibody (Catalog # PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human HBEGF (Iv0076)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products