Brand: ProteoGenix

InVivoMAb Anti-Dog IL31 Antibody (Iv0214)

ARO-A13027-100
Quality Chart

Clonality:: Monoclonal Antibody
Host species:: Dog

Original price was: €494.00.Current price is: €366.00.

100ug 26% OFF + 366 loyalty points

Size Size

50ug Original price was: €328.00.Current price is: €256.00.
100ug Original price was: €494.00.Current price is: €366.00.
1MG Original price was: €1,485.00.Current price is: €1,061.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

InVivoMAb Anti-Dog IL31 Antibody (Iv0214)

Product name	ARO-A13027-100
Uniprot ID	C7G0W1
Raw Antigen Sequence	MLSHTGPSRFALFLLCSMETLLSSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQ
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Dog
Aliases /Synonyms	Anti-IL-31, Interleukin-31, IL31
Reference	ARO-A13027
Clonality	Monoclonal Antibody
Protein Name	IL-31

Product name	ARO-A13027-1MG
Uniprot ID	C7G0W1
Raw Antigen Sequence	MLSHTGPSRFALFLLCSMETLLSSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQ
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Dog
Aliases /Synonyms	Anti-IL-31, Interleukin-31, IL31
Reference	ARO-A13027
Clonality	Monoclonal Antibody
Protein Name	IL-31

Product name	ARO-A13027-50
Uniprot ID	C7G0W1
Raw Antigen Sequence	MLSHTGPSRFALFLLCSMETLLSSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQ
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Dog
Aliases /Synonyms	Anti-IL-31, Interleukin-31, IL31
Reference	ARO-A13027
Clonality	Monoclonal Antibody
Protein Name	IL-31

Datasheet

SDS-PAGE for InVivoMAb Anti-Dog IL31 Antibody (Iv0214)

InVivoMAb Anti-Dog IL31 Antibody (Iv0214), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Dog IL31 Antibody (Iv0214)”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *