Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Interleukin-1 receptor antagonist protein(IL1RN)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P18510
Molecular weight:
18kDa

Original price was: €215.00.Current price is: €182.00.

50ug 15% OFF + 182 loyalty points
Arg26–Glu177 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Interleukin-1 receptor antagonist protein(IL1RN)

Product name Interleukin-1 receptor antagonist protein(IL1RN)
Uniprot ID P18510
Uniprot link https://www.uniprot.org/uniprot/P18510#P18510
Expression system Prokaryotic expression
Raw Antigen Sequence RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Molecular weight 18kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Bacillus subtilis
Fragment Type Arg26-Glu177
Protein Accession P18510
Spec:Entrez GeneID 3557
Spec:NCBI Gene Aliases DIRA; IRAP; IL1F3; IL1RA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA
Spec:SwissProtID Q14628
NCBI Reference P18510
Aliases /Synonyms IL-1RN,IL-1ra,IRAP,ICIL-1RA,IL1 inhibitor,INN: Anakinra,IL1F3, IL1RA
Reference PX-P4651
Note For research use only
Molecular Constructor
Arg26–Glu177 His
Product name Interleukin-1 receptor antagonist protein(IL1RN)
Uniprot ID P18510
Uniprot link https://www.uniprot.org/uniprot/P18510#P18510
Expression system Prokaryotic expression
Raw Antigen Sequence RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Molecular weight 18kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Bacillus subtilis
Fragment Type Arg26-Glu177
Protein Accession P18510
Spec:Entrez GeneID 3557
Spec:NCBI Gene Aliases DIRA; IRAP; IL1F3; IL1RA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA
Spec:SwissProtID Q14628
NCBI Reference P18510
Aliases /Synonyms IL-1RN,IL-1ra,IRAP,ICIL-1RA,IL1 inhibitor,INN: Anakinra,IL1F3, IL1RA
Reference PX-P4651
Note For research use only
Molecular Constructor
Arg26–Glu177 His
Product name PX-P4651-1MG
Uniprot ID P18510
Uniprot link https://www.uniprot.org/uniprot/P18510#P18510
Expression system Prokaryotic expression
Raw Antigen Sequence RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Molecular weight 18kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg26-Glu177
Protein Accession P18510
Spec:Entrez GeneID 3557
Spec:NCBI Gene Aliases DIRA; IRAP; IL1F3; IL1RA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA
Spec:SwissProtID Q14628
NCBI Reference P18510
Aliases /Synonyms IL-1RN,IL-1ra,IRAP,ICIL-1RA,IL1 inhibitor,INN: Anakinra,IL1F3, IL1RA
Reference PX-P4651
Note For research use only
Molecular Constructor
Arg26–Glu177 His

SDS-PAGE for Interferon-induced helicase C domain-containing protein 1 (IFIH1)

SDS-PAGE for Interferon-induced helicase C domain-containing protein 1 (IFIH1)

Interferon-induced helicase C domain-containing protein 1 (IFIH1) on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is superior than 90 %

Interleukin-1 receptor antagonist protein(IL1RN)

There are no reviews yet.

Be the first to review “Interleukin-1 receptor antagonist protein(IL1RN)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products