Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Interleukin-1 receptor antagonist protein(IL1RN)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Interleukin-1 receptor antagonist protein(IL1RN) |
|---|---|
| Uniprot ID | P18510 |
| Uniprot link | https://www.uniprot.org/uniprot/P18510#P18510 |
| Expression system | Prokaryotic expression |
| Sequence | RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDEGSHHHHHH |
| Molecular weight | 18kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90%by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Arg26-Glu177 |
| Protein Accession | P18510 |
| Spec:Entrez GeneID | 3557 |
| Spec:NCBI Gene Aliases | DIRA; IRAP; IL1F3; IL1RA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA |
| Spec:SwissProtID | Q14628 |
| NCBI Reference | P18510 |
| Aliases /Synonyms | IL-1RN,IL-1ra,IRAP,ICIL-1RA,IL1 inhibitor,INN: Anakinra,IL1F3, IL1RA |
| Reference | PX-P4651 |
| Note | For research use only |
Related products
Biosimilar
Nidanilimab Biosimilar – Anti-IL1RAP mAb – Research Grade
PX-TA1571 200€
Biosimilar
Nadunolimab Biosimilar – Anti-IL1RAP mAb – Research Grade
PX-TA1867 200€
Tag Antibody
Anti His tag mouse monoclonal antibody
PTX17851 180€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.