Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Interleukin-1 alpha(IL1A)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P01583
Molecular weight:
19.2kDa

Original price was: €206.00.Current price is: €182.00.

50ug 12% OFF + 182 loyalty points
Ser113–Ala271
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Interleukin-1 alpha(IL1A)

Product name Interleukin-1 alpha(IL1A)
Uniprot ID P01583
Uniprot link http://www.uniprot.org/uniprot/P01583
Expression system Prokaryotic expression
Raw Antigen Sequence SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Molecular weight 19.2kDa
Purity estimated >90% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 8.0, 150 mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser113-Ala271
Aliases /Synonyms IL1F1,Hematopoietin-1
Reference PX-P4588
Note For research use only
Molecular Constructor
Ser113–Ala271
Product name Interleukin-1 alpha(IL1A)
Uniprot ID P01583
Uniprot link http://www.uniprot.org/uniprot/P01583
Expression system Prokaryotic expression
Raw Antigen Sequence SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Molecular weight 19.2kDa
Purity estimated >90% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 8.0, 150 mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser113-Ala271
Aliases /Synonyms IL1F1,Hematopoietin-1
Reference PX-P4588
Note For research use only
Molecular Constructor
Ser113–Ala271
Product name PX-P4588-1MG
Uniprot ID P01583
Uniprot link http://www.uniprot.org/uniprot/P01583
Expression system Prokaryotic expression
Raw Antigen Sequence SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Molecular weight 19.2kDa
Purity estimated >90% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 8.0, 150 mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser113-Ala271
Aliases /Synonyms IL1F1,Hematopoietin-1
Reference PX-P4588
Note For research use only
Molecular Constructor
Ser113–Ala271

General Information about Interleukin-1 alpha (IL1)

The protein encoded by this gene is a member of the interleukin-1 cytokine family. This cytokine is a pleiotropic cytokine involved in a variety of immune responses, inflammatory processes and hematopoiesis. The cytokine is produced by monocytes and macrophages in the form of proprotein, which is proteolytically processed and released in response to cell damage, thereby inducing apoptosis. This gene and 8 other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been shown that these gene polymorphisms are related to rheumatoid arthritis and Alzheimer’s disease.

Interleukin-1 alpha(IL1A)

There are no reviews yet.

Be the first to review “Interleukin-1 alpha(IL1A)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products