Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Imalumab Biosimilar – Anti-MIF mAb – Research Grade

  • PX-TA1359-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €179.00.Current price is: €140.00.

50ug 22% OFF + 140 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Imalumab Biosimilar - Anti-MIF mAb
Imalumab Biosimilar - Anti-MIF;GIF mAb - Research Grade binds to MIF, C-His, recombinant protein in ELISA Assay
Imalumab Biosimilar - Anti-MIF mAb - Research Grade

Imalumab Biosimilar - Anti-MIF mAb - Research Grade

Product name Imalumab Biosimilar - Anti-MIF mAb - Research Grade
Uniprot ID P14174
Source CAS 1430205-07-4
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Imalumab,BAX069,BAX69,MIF,anti-MIF
Reference PX-TA1359
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Imalumab Biosimilar - Anti-MIF mAb - Research Grade
Uniprot ID P14174
Source CAS 1430205-07-4
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Imalumab,BAX069,BAX69,MIF,anti-MIF
Reference PX-TA1359
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1359-50
Uniprot ID P14174
Source CAS 1430205-07-4
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Imalumab,BAX069,BAX69,MIF,anti-MIF
Reference PX-TA1359
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-MIF[Homo sapiens] (Imalumab) Monoclonal Antibody

Imalumab is investigatedfor the treatment of Malignant Ascites of Ovarian Cancer.

SDS-PAGE for Imalumab Biosimilar - Anti-MIF mAb

SDS-PAGE for Imalumab Biosimilar - Anti-MIF mAb

Imalumab Biosimilar - Anti-MIF mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Imalumab Biosimilar - Anti-MIF;GIF mAb - Research Grade binds to MIF, C-His, recombinant protein in ELISA Assay

Imalumab Biosimilar - Anti-MIF;GIF mAb - Research Grade binds to MIF, C-His, recombinant protein in ELISA Assay

MIF, C-His, recombinant protein(cat. No.PX-P5828) at 0.5µg/mL (100µL/well) can bind Imalumab Biosimilar - Anti-MIF;GIF mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Imalumab Biosimilar - Anti-MIF mAb - Research Grade

There are no reviews yet.

Be the first to review “Imalumab Biosimilar – Anti-MIF mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products