Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q7Z7D3
Molecular weight:
28.73kDa

Original price was: €248.00.Current price is: €210.00.

50ug 15% OFF + 210 loyalty points
Partial Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein

Product name Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein
Uniprot ID Q7Z7D3
Uniprot link http://www.uniprot.org/uniprot/Q7Z7D3
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIAFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKAGSHHHHHH
Molecular weight 28.73kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms B7-H4, B7H4, B7S1, B7X, B7h.5, VCTN1, T-cell costimulatory molecule B7x, Immune costimulatory protein B7-H4, VTCN1
Reference PX-P4045
Note For research use only
Molecular Constructor
Partial Yes
Product name Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein
Uniprot ID Q7Z7D3
Uniprot link http://www.uniprot.org/uniprot/Q7Z7D3
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIAFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKAGSHHHHHH
Molecular weight 28.73kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms B7-H4, B7H4, B7S1, B7X, B7h.5, VCTN1, T-cell costimulatory molecule B7x, Immune costimulatory protein B7-H4, VTCN1
Reference PX-P4045
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P4045-1MG
Uniprot ID Q7Z7D3
Uniprot link http://www.uniprot.org/uniprot/Q7Z7D3
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIAFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKAGSHHHHHH
Molecular weight 28.73kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms B7-H4, B7H4, B7S1, B7X, B7h.5, VCTN1, T-cell costimulatory molecule B7x, Immune costimulatory protein B7-H4, VTCN1
Reference PX-P4045
Note For research use only
Molecular Constructor
Partial Yes

Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein

There are no reviews yet.

Be the first to review “Human V-set domain-containing T-cell activation inhibitor 1(VTCN1)/B7H4 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products