Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Troponin C, slow skeletal and cardiac muscles (TNNC1) recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P63316
Molecular weight:
9.67kDa

Original price was: €273.00.Current price is: €210.00.

50ug 23% OFF + 210 loyalty points
Full-length Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Troponin C, slow skeletal and cardiac muscles (TNNC1) recombinant protein

Product name Human Troponin C, slow skeletal and cardiac muscles (TNNC1) recombinant protein
Uniprot ID P63316
Uniprot link http://www.uniprot.org/uniprot/P63316
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Molecular weight 9.67kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer 50 mM Tris-HCl pH 8, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms Cardiac troponin C, CMD1Z, CMH13, slow skeletal and cardiac muscles, Slow twitch skeletal/cardiac muscle troponin C, TN-C, TNC, TNNC, Tnnc1, TNNC1 troponin C type 1 (slow), TNNC1_HUMAN, Troponin C, troponin C type 1 (slow), Troponin C, slow skeletal and cardiac muscles, Troponin C1, slow
Reference PX-P4048
Note For research use only
Molecular Constructor
Full-length Yes
Product name Human Troponin C, slow skeletal and cardiac muscles (TNNC1) recombinant protein
Uniprot ID P63316
Uniprot link http://www.uniprot.org/uniprot/P63316
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Molecular weight 9.67kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer 50 mM Tris-HCl pH 8, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms Cardiac troponin C, CMD1Z, CMH13, slow skeletal and cardiac muscles, Slow twitch skeletal/cardiac muscle troponin C, TN-C, TNC, TNNC, Tnnc1, TNNC1 troponin C type 1 (slow), TNNC1_HUMAN, Troponin C, troponin C type 1 (slow), Troponin C, slow skeletal and cardiac muscles, Troponin C1, slow
Reference PX-P4048
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P4048-1MG
Uniprot ID P63316
Uniprot link http://www.uniprot.org/uniprot/P63316
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Molecular weight 9.67kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer 50 mM Tris-HCl pH 8, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms Cardiac troponin C, CMD1Z, CMH13, slow skeletal and cardiac muscles, Slow twitch skeletal/cardiac muscle troponin C, TN-C, TNC, TNNC, Tnnc1, TNNC1 troponin C type 1 (slow), TNNC1_HUMAN, Troponin C, troponin C type 1 (slow), Troponin C, slow skeletal and cardiac muscles, Troponin C1, slow
Reference PX-P4048
Note For research use only
Molecular Constructor
Full-length Yes

General Information about Human Troponin C, slow skeletal and cardiac muscles (TNNC1) recombinant protein

Troponin is the central regulator of striated muscle contraction. Tn consists of three parts: Tn-I is an actinomycin ATPase inhibitor, and Tn-T contains the tropomyosin and Tn-C binding site. The combination of calcium and Tn-C eliminates the inhibitory effect of Tn on the actin filaments.

Human Troponin C, slow skeletal and cardiac muscles (TNNC1) recombinant protein

There are no reviews yet.

Be the first to review “Human Troponin C, slow skeletal and cardiac muscles (TNNC1) recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products