Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Prorelaxin H2(RLN2)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P04090
Molecular weight:
18.44 kDa

142.00

100ug + 142 loyalty points
His Val23–Cys185
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Prorelaxin H2(RLN2)

Product name Prorelaxin H2(RLN2)
Uniprot ID P04090
Uniprot link https://www.uniprot.org/uniprot/P04090
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence VADSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETINMMSEFVANL PQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRKKRQLYSA LANKCCHVGCTKRSLARFC*
Molecular weight 18.44 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val23-Cys185
Protein Accession P04090
Spec:Entrez GeneID 6019
Spec:NCBI Gene Aliases H2; RLXH2; H2-RLX; bA12D24.1.1; bA12D24.1.2
Spec:SwissProtID Q9UQJ2
NCBI Reference P04090
Aliases /Synonyms /
Reference PX-P4791
Note For research use only
Molecular Constructor
His Val23–Cys185
Product name Prorelaxin H2(RLN2)
Uniprot ID P04090
Uniprot link https://www.uniprot.org/uniprot/P04090
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence VADSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETINMMSEFVANL PQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRKKRQLYSA LANKCCHVGCTKRSLARFC*
Molecular weight 18.44 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val23-Cys185
Protein Accession P04090
Spec:Entrez GeneID 6019
Spec:NCBI Gene Aliases H2; RLXH2; H2-RLX; bA12D24.1.1; bA12D24.1.2
Spec:SwissProtID Q9UQJ2
NCBI Reference P04090
Aliases /Synonyms /
Reference PX-P4791
Note For research use only
Molecular Constructor
His Val23–Cys185

There are no reviews yet.

Be the first to review “Prorelaxin H2(RLN2)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products