Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human TACSTD2/TROP2 Monoclonal Antibody

  • ARO-A16172-50
  • Validated FC

Original price was: €310.00.Current price is: €231.00.

50ug 25% OFF + 231 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human TACSTD2/TROP2 Monoclonal Antibody

Product name ARO-A16172-100
Uniprot ID P09758
Uniprot link P09758
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Pancreatic carcinoma marker protein GA733-1, Tumor-associated calcium signal transducer 2, M1S1, TROP2, TACSTD2, Cell surface glycoprotein Trop-2, GA733-1, Membrane component chromosome 1 surface marker 1
Reference ARO-A16172
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TACSTD2/TROP2
Clone Name SAA0113
Protein Name TACSTD2/TROP2
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16172-1MG
Uniprot ID P09758
Uniprot link P09758
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Pancreatic carcinoma marker protein GA733-1, Tumor-associated calcium signal transducer 2, M1S1, TROP2, TACSTD2, Cell surface glycoprotein Trop-2, GA733-1, Membrane component chromosome 1 surface marker 1
Reference ARO-A16172
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TACSTD2/TROP2
Clone Name SAA0113
Protein Name TACSTD2/TROP2
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16172-50
Uniprot ID P09758
Uniprot link P09758
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Pancreatic carcinoma marker protein GA733-1, Tumor-associated calcium signal transducer 2, M1S1, TROP2, TACSTD2, Cell surface glycoprotein Trop-2, GA733-1, Membrane component chromosome 1 surface marker 1
Reference ARO-A16172
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TACSTD2/TROP2
Clone Name SAA0113
Protein Name TACSTD2/TROP2
Target species Anti-Human Monoclonal Antibody

Flow Cytometry results for Human TACSTD2/TROP2 Monoclonal Antibody

Flow Cytometry results for Human TACSTD2/TROP2 Monoclonal Antibody

Target Cells were stained with an irrelevant antibody or Human TACSTD2/TROP2 Monoclonal Antibody at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Human TACSTD2/TROP2 Monoclonal Antibody

Flow Cytometry results for Human TACSTD2/TROP2 Monoclonal Antibody

Target Cells were stained with an irrelevant antibody or Human TACSTD2/TROP2 Monoclonal Antibody at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Human TACSTD2/TROP2 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human TACSTD2/TROP2 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products