Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human Serum amyloid A-1 protein(SAA1) Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human Serum amyloid A-1 protein(SAA1) Recombinant Protein |
|---|---|
| Uniprot ID | P0DJI8 |
| Uniprot link | http://www.uniprot.org/uniprot/P0DJI8 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MNHKVHHHHHHMRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
| Molecular weight | 13.2 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | Tris-HC 50mMl, NaCl 150mM, pH7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Spec:NCBI Gene Aliases | SAA1 |
| NCBI Reference | P0DJI8 |
| Aliases /Synonyms | Serum amyloid A-1 protein, SAA, Amyloid fibril protein AA |
| Reference | PX-P3003 |
| Note | For research use only |
Related products
Biosimilar
Birtamimab Biosimilar – Anti-SAA1 mAb – Research Grade
PX-TA1428 200€
Biosimilar
Anselamimab Biosimilar – Anti-Serum amyloid A-1 mAb – Research Grade
PX-TA1775 200€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.