Brand: ProteoGenix

Human RHOD Recombinant Protein, N-His

ARO-P19649-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Human
Uniprot ID:: O00212
Molecular weight:: 25.23 kDa

Original price was: €255.00.Current price is: €228.00.

50ug 11% OFF + 228 loyalty points

His Met1–Phe206

Size Size

50ug Original price was: €255.00.Current price is: €228.00.
100ug Original price was: €364.00.Current price is: €325.00.
1MG Original price was: €1,084.00.Current price is: €943.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Human RHOD Recombinant Protein, N-His

Product name	ARO-P19649-100
Uniprot ID	O00212
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLRKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGF
Molecular weight	25.23 kDa
Protein delivered with Tag?	N-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met1-Phe206
Aliases /Synonyms	ARHD, RHOD, Rho-related GTP-binding protein RhoD, Rho-related protein HP1, RhoHP1
Reference	ARO-P19649
Note	For research use only.
Molecular Constructor	His Met1–Phe206

Product name	ARO-P19649-1MG
Uniprot ID	O00212
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLRKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGF
Molecular weight	25.23 kDa
Protein delivered with Tag?	N-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met1-Phe206
Aliases /Synonyms	ARHD, RHOD, Rho-related GTP-binding protein RhoD, Rho-related protein HP1, RhoHP1
Reference	ARO-P19649
Note	For research use only.
Molecular Constructor	His Met1–Phe206

Product name	ARO-P19649-50
Uniprot ID	O00212
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLRKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGF
Molecular weight	25.23 kDa
Protein delivered with Tag?	N-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met1-Phe206
Aliases /Synonyms	ARHD, RHOD, Rho-related GTP-binding protein RhoD, Rho-related protein HP1, RhoHP1
Reference	ARO-P19649
Note	For research use only.
Molecular Constructor	His Met1–Phe206