Brand: ProteoGenix

Human MSTN/GDF8 Recombinant Protein, N-Fc

ARO-P17784-50
Quality Chart

Host species:: Mammalian cells
Origin species:: Human
Uniprot ID:: O14793

Original price was: €285.00.Current price is: €228.00.

50ug 20% OFF + 228 loyalty points

Fc Asp268–Ser376

Size Size

50ug Original price was: €285.00.Current price is: €228.00.
100ug Original price was: €400.00.Current price is: €325.00.
1MG Original price was: €1,075.00.Current price is: €943.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Human MSTN/GDF8 Recombinant Protein, N-Fc

Product name	ARO-P17784-100
Uniprot ID	O14793
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGC
Protein delivered with Tag?	N-Terminal Fc Tag
Buffer	Lyophilized from PBS pH7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Asp268-Ser376
Aliases /Synonyms	Growth/differentiation factor 8, GDF-8, Myostatin, MSTN
Reference	ARO-P17784
Note	For research use only.
Molecular Constructor	Fc Asp268–Ser376

Product name	ARO-P17784-1MG
Uniprot ID	O14793
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGC
Protein delivered with Tag?	N-Terminal Fc Tag
Buffer	Lyophilized from PBS pH7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Asp268-Ser376
Aliases /Synonyms	Growth/differentiation factor 8, GDF-8, Myostatin, MSTN
Reference	ARO-P17784
Note	For research use only.
Molecular Constructor	Fc Asp268–Ser376

Product name	ARO-P17784-50
Uniprot ID	O14793
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGC
Protein delivered with Tag?	N-Terminal Fc Tag
Buffer	Lyophilized from PBS pH7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Asp268-Ser376
Aliases /Synonyms	Growth/differentiation factor 8, GDF-8, Myostatin, MSTN
Reference	ARO-P17784
Note	For research use only.
Molecular Constructor	Fc Asp268–Ser376