Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human LRP1 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q07954
Molecular weight:
30.52 kDa

Original price was: €231.00.Current price is: €210.00.

50ug 9% OFF + 210 loyalty points
Partial Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human LRP1 Recombinant Protein

Product name Human LRP1 Recombinant Protein
Uniprot ID Q07954
Uniprot link http://www.uniprot.org/uniprot/Q07954
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
Molecular weight 30.52 kDa
Protein delivered with Tag? Yes
Purity estimated 40%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference Q07954
Aliases /Synonyms Low Density Lipoprotein Receptor Related Protein 1, CD91, LRP, A2MR, APOER, APR, TGFBR5, Alpha-2-Macroglobulin Receptor, Prolow-density lipoprotein receptor-related protein 1, Apolipoprotein E receptor
Reference PX-P3046
Note For research use only
Molecular Constructor
Partial Yes
Product name Human LRP1 Recombinant Protein
Uniprot ID Q07954
Uniprot link http://www.uniprot.org/uniprot/Q07954
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
Molecular weight 30.52 kDa
Protein delivered with Tag? Yes
Purity estimated 40%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference Q07954
Aliases /Synonyms Low Density Lipoprotein Receptor Related Protein 1, CD91, LRP, A2MR, APOER, APR, TGFBR5, Alpha-2-Macroglobulin Receptor, Prolow-density lipoprotein receptor-related protein 1, Apolipoprotein E receptor
Reference PX-P3046
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P3046-1MG
Uniprot ID Q07954
Uniprot link http://www.uniprot.org/uniprot/Q07954
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
Molecular weight 30.52 kDa
Protein delivered with Tag? Yes
Purity estimated 40%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference Q07954
Aliases /Synonyms Low Density Lipoprotein Receptor Related Protein 1, CD91, LRP, A2MR, APOER, APR, TGFBR5, Alpha-2-Macroglobulin Receptor, Prolow-density lipoprotein receptor-related protein 1, Apolipoprotein E receptor
Reference PX-P3046
Note For research use only
Molecular Constructor
Partial Yes

About LRP1 protein

Low density lipoprotein receptor-related protein 1 (LRP1) is a receptor located in the cell membrane of cells required in phagocytosis of apoptotic cells and endocytosis mediated by receptor. This protein is also known as alpha-2-macroglobulin receptor (A2MR), as it is involved in early embryonic development-and known as cluster of differentiation 91 (CD91), sometimes apolipoprotein E receptor (APOER). It is encoded on chromosome 12 by LRP1 gene in humans and its expression is ubiquitous. LRP1 belongs to the Low Density Lipoprotein Receptor (LDLR) family protein.

LRP1 is involved in many biological processes and signaling pathways. LRP1 protein is especially playing a key role in lipoprotein metabolism (plasma clearance of chylomicron remnants, cellular lipid homeostasis… but some functions may still be resolved to date); cell motility with kinase-dependent intracellular signaling; Amyloid Precursor Protein (APP) metabolism, and neuronal calcium signaling in neurotransmission. Some diseases such as neurodegenerative one may be caused by dysfunctions of LRP1 pathways. Indeed, LRP1 is able to link proteins from extracellular matrix, growth factor, proteases and their inhibitors.

Structure and interactions of LRP1

LRP1 is composed of two chain non-covalently linked. The α- chain, composed of four ligand-binding domain, is extracellular. These binding domains contain cysteine-rich complement-type repeats. Domains II and IV are responsible of the majority of the protein’s binding. The EGF repeats and β propeller domains allow the release of ligands in endosomes (which have lower pH conditions). The β-chain is the transmembrane domain. It contains a cytoplasmic tail composed of hundred residues. These residues compose two NPxY motifs. These motifs are responsible for the protein’s function, especially in endocytosis and signal transduction.The recombinant human LRP1 isoform is fused with a N-terminal His tag.

Human LRP1 Recombinant Protein

There are no reviews yet.

Be the first to review “Human LRP1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products