Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human IZUMO1R recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
A6ND01
Molecular weight:
26.94 kDa

Original price was: €338.00.Current price is: €277.00.

50ug 18% OFF + 277 loyalty points
Gly20–Ser228 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human IZUMO1R recombinant protein

Human IZUMO1R recombinant protein

Product name PX-P6535-100
Uniprot ID A6ND01
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFAS
Molecular weight 26.94 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly20-Ser228
Aliases /Synonyms JUNO, Sperm-egg fusion protein Juno, FOLR4, IZUMO1R, Folate receptor delta, FR-delta, Folate receptor 4IZUMO1 receptor protein JUNO,
Reference PX-P6535
Molecular Constructor
Gly20–Ser228 His
Product name PX-P6535-1MG
Uniprot ID A6ND01
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFAS
Molecular weight 26.94 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly20-Ser228
Aliases /Synonyms JUNO, Sperm-egg fusion protein Juno, FOLR4, IZUMO1R, Folate receptor delta, FR-delta, Folate receptor 4IZUMO1 receptor protein JUNO,
Reference PX-P6535
Molecular Constructor
Gly20–Ser228 His
Product name PX-P6535-50
Uniprot ID A6ND01
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFAS
Molecular weight 26.94 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly20-Ser228
Aliases /Synonyms JUNO, Sperm-egg fusion protein Juno, FOLR4, IZUMO1R, Folate receptor delta, FR-delta, Folate receptor 4IZUMO1 receptor protein JUNO,
Reference PX-P6535
Molecular Constructor
Gly20–Ser228 His

There are no reviews yet.

Be the first to review “Human IZUMO1R recombinant protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products