Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human Intra Acrosomal,SP-10 recombinant protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human Intra Acrosomal,SP-10 recombinant protein |
|---|---|
| Uniprot ID | P26436 |
| Uniprot link | http://www.uniprot.org/uniprot/P26436 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKIGSHHHHHH |
| Molecular weight | 29.7kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | PBS, pH 7.5 |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Full-length |
| Aliases /Synonyms | Acrosomal protein SP 10, Acrosomal protein SP-10, Acrosomal vesicle protein 1, ACRV1, ASPX_HUMAN, D11S4365, Msa63, SP 10, Sp10, SPACA2, Sperm protein 10 |
| Reference | PX-P4029 |
| Note | For research use only. |
Related products
Biosimilar
Adintrevimab Biosimilar – Anti-Spike RBD mAb – Research Grade
PX-TA1803 370€
Biosimilar
Bintrafusp Biosimilar – Anti-CD274 mAb – Research Grade
PX-TA1819 200€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.