Cart (0 Items)
Your cart is currently empty.
View Products 
               
               
              | size | 100ug, 50ug | 
|---|---|
| Brand | ProteoGenix | 
| Product type | Recombinant Proteins | 
| Host Species | Mammalian cells | 
| Applications | Elisa, WB | 
| Product name | Human Interleukin-12 subunit beta(IL12B) | 
|---|---|
| Uniprot ID | P29460 | 
| Uniprot link | https://www.uniprot.org/uniprot/P29460 | 
| Origin species | Homo sapiens (Human) | 
| Expression system | Eukaryotic expression | 
| Sequence | MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS | 
| Molecular weight | 38.2kDa | 
| Protein delivered with Tag? | C-terminal His Tag | 
| Purity estimated | >95% by SDS-PAGE | 
| Buffer | PBS pH 7.5 | 
| Delivery condition | Dry Ice | 
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days | 
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) | 
| Brand | ProteoGenix | 
| Host species | Mammalian cells | 
| Fragment Type | Met1-Ser328 | 
| Protein Accession | P29460 | 
| Spec:Entrez GeneID | 3593 | 
| Spec:NCBI Gene Aliases | CLMF; NKSF; CLMF2; IMD28; IMD29; NKSF2; IL-12B | 
| NCBI Reference | P29460 | 
| Aliases /Synonyms | NKSF2 | 
| Reference | PX-P4561 | 
| Note | For research use only | 
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.