Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human IL33 isoform 1 partial (112-270) recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O95760
Molecular weight:
19.92kDa

Original price was: €271.00.Current price is: €210.00.

50ug 23% OFF + 210 loyalty points
Partial Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human IL33 isoform 1 partial (112-270) recombinant protein

Product name Human IL33 isoform 1 partial (112-270) recombinant protein
Uniprot ID O95760
Uniprot link http://www.uniprot.org/uniprot/O95760
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGDDDDKMSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Molecular weight 19.92kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Aliases /Synonyms DV27, C9ORF26, IL1F11, NFHEV, Interleukin-1 Family, Member 11, Nuclear factor from high endothelial venules, Interleukin 33, IL33,IL33 isoform 1 partial (112-270)
Reference PX-P4020
Note For research use only
Molecular Constructor
Partial Yes
Product name Human IL33 isoform 1 partial (112-270) recombinant protein
Uniprot ID O95760
Uniprot link http://www.uniprot.org/uniprot/O95760
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGDDDDKMSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Molecular weight 19.92kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Aliases /Synonyms DV27, C9ORF26, IL1F11, NFHEV, Interleukin-1 Family, Member 11, Nuclear factor from high endothelial venules, Interleukin 33, IL33,IL33 isoform 1 partial (112-270)
Reference PX-P4020
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P4020-1MG
Uniprot ID O95760
Uniprot link http://www.uniprot.org/uniprot/O95760
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGDDDDKMSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Molecular weight 19.92kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Aliases /Synonyms DV27, C9ORF26, IL1F11, NFHEV, Interleukin-1 Family, Member 11, Nuclear factor from high endothelial venules, Interleukin 33, IL33,IL33 isoform 1 partial (112-270)
Reference PX-P4020
Note For research use only
Molecular Constructor
Partial Yes

Human IL33 isoform 1 partial (112-270) recombinant protein

There are no reviews yet.

Be the first to review “Human IL33 isoform 1 partial (112-270) recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products