Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human IL33 isoform 1 partial (112-270) recombinant protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human IL33 isoform 1 partial (112-270) recombinant protein |
|---|---|
| Uniprot ID | O95760 |
| Uniprot link | http://www.uniprot.org/uniprot/O95760 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MGSHHHHHHSGDDDDKMSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET |
| Molecular weight | 19.92kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 85% |
| Buffer | PBS, pH 7.5 |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Aliases /Synonyms | DV27, C9ORF26, IL1F11, NFHEV, Interleukin-1 Family, Member 11, Nuclear factor from high endothelial venules, Interleukin 33, IL33,IL33 isoform 1 partial (112-270) |
| Reference | PX-P4020 |
| Note | For research use only |
Related products
Biosimilar
Etokimab Biosimilar – Anti-IL33 mAb – Research Grade
PX-TA1546 200€
Biosimilar
Torudokimab Biosimilar – Anti-IL33 mAb – Research Grade
PX-TA1727 200€
Biosimilar
Tozorakimab Biosimilar – Anti-IL33 mAb – Research Grade
PX-TA1728 200€
Biosimilar
Itepekimab Biosimilar – Anti-IL33 mAb – Research Grade
PX-TA1852 200€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.