Cart (0 Items)
Your cart is currently empty.
View ProductsHuman HA-HSP27 Recombinant Protein
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human HA-HSP27 Recombinant Protein |
|---|---|
| Uniprot ID | P04792 |
| Uniprot link | http://www.uniprot.org/uniprot/P04792 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MAHNHRHKHKLMAYPYDVPDYASLGGHMTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPG YVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGY ISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK |
| Molecular weight | 25,86 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | >95% |
| Buffer | PBS, imidazole 300mM. PBS only if dialysis |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Applications | ELISA,WB |
| Fragment Type | Full-length |
| Protein Accession | NP_001531.1 |
| Spec:Entrez GeneID | 3315 |
| Spec:NCBI Gene Aliases | HMN2B, HS.76067, HSP27, HEL-S-102, CMT2F, SRP27, Hsp25, HSP28 |
| Spec:SwissProtID | P04792 |
| NCBI Reference | NP_001531.1 |
| Aliases /Synonyms | HA-HSP27, Heat Shock 27kDa Protein 1 / heat shock protein beta-1 |
| Reference | PX-P1109 |
| Note | For research use only |
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.