Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human FOLH1-PSMA recombinant protein

Host species:
Insect
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q04609
Molecular weight:
86.36 kDa

€420.00

100ug + 420 loyalty points
Strep Lys44–Ala750
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human FOLH1-PSMA recombinant protein

Product name Human FOLH1-PSMA recombinant protein
Uniprot ID Q04609
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Molecular weight 86.36 kDa
Protein delivered with Tag? N-Terminal Strep Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Lys44-Ala750
Aliases /Synonyms NAALAD1, Prostate-specific membrane antigen, NAALADase I, PSMA, PSM, Pteroylpoly-gamma-glutamate carboxypeptidase, Glutamate carboxypeptidase 2, N-acetylated-alpha-linked acidic dipeptidase I, Glutamate carboxypeptidase II, FOLH1, FGCP, FOLH, Folylpoly-gamma-glutamate carboxypeptidase, Folate hydrolase 1, GCPII, Membrane glutamate carboxypeptidase, Cell growth-inhibiting gene 27 protein, mGCP, Drug Target
Reference PX-P6122
Note For research use only
Molecular Constructor
Strep Lys44–Ala750

Human FOLH1-PSMA recombinant protein

There are no reviews yet.

Be the first to review “Human FOLH1-PSMA recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products