Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Human FGF2b Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P09038
Molecular weight:
17,76 kDa

210.00

50ug + 210 loyalty points
Partial Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human FGF2b Recombinant Protein

Product name Human FGF2b Recombinant Protein
Uniprot ID P09038
Uniprot link http://www.uniprot.org/uniprot/P09038
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVC ANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Molecular weight 17,76 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAA52534.1
Spec:Entrez GeneID 2247
Spec:NCBI Gene Aliases FGFB, HBGF-2, FGF-2, BFGF
Spec:SwissProtID P09038
NCBI Reference AAA52534.1
Aliases /Synonyms FGF2b, basic fibroblast Growth Factor proteins, FGF2, Fibroblast Growth Factor proteins 2, FGF-2, bFGF, Heparin-binding Growth Factor proteins 2, HBGF-2
Reference PX-P1089
Note For research use only
Molecular Constructor
Partial Yes
Product name Human FGF2b Recombinant Protein
Uniprot ID P09038
Uniprot link http://www.uniprot.org/uniprot/P09038
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVC ANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Molecular weight 17,76 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAA52534.1
Spec:Entrez GeneID 2247
Spec:NCBI Gene Aliases FGFB, HBGF-2, FGF-2, BFGF
Spec:SwissProtID P09038
NCBI Reference AAA52534.1
Aliases /Synonyms FGF2b, basic fibroblast Growth Factor proteins, FGF2, Fibroblast Growth Factor proteins 2, FGF-2, bFGF, Heparin-binding Growth Factor proteins 2, HBGF-2
Reference PX-P1089
Note For research use only
Molecular Constructor
Partial Yes

  • Wróbel T, Butrym A, Łacina P, Rybka J, Gębura K, Mazur G, Bogunia-Kubik K. bFGF Polymorphism Is Associated with Disease Progression and Response to Chemotherapy in Multiple Myeloma Patients. Anticancer Res. 2017 Apr;37(4):1799-1803. PubMed PMID: 28373444.
  • Neutralizing Monoclonal Antibody 3B1 Against Human Basic Fibroblast Growth Factor. Monoclon Antib Immunodiagn Immunother. 2016 Apr;35(2):122. doi: 10.1089/mab.2015.0080. PubMed PMID: 27097071.
  • Hao RH, Guo Y, Dong SS, Weng GZ, Yan H, Zhu DL, Chen XF, Chen JB, Yang TL. Associations of Plasma FGF2 Levels and Polymorphisms in the FGF2 Gene with Obesity Phenotypes in Han Chinese Population. Sci Rep. 2016 Feb 16;6:19868. doi: 10.1038/srep19868. PubMed PMID: 26879180; PubMed Central PMCID: PMC4754629.
  • Shi H, Xu J, Zhao R, Wu H, Gu L, Chen Y. FGF2 regulates proliferation, migration, and invasion of ECA109 cells through PI3K/Akt signalling pathway in vitro. Cell Biol Int. 2016 May;40(5):524-33. doi: 10.1002/cbin.10588. Epub 2016 Mar 9. PubMed PMID: 26833879.
  • Hu M, Hu Y, He J, Li B. Prognostic Value of Basic Fibroblast Growth Factor proteins (bFGF) in Lung Cancer: A Systematic Review with Meta-Analysis. PLoS One. 2016 Jan 29;11(1):e0147374. doi: 10.1371/journal.pone.0147374. eCollection 2016. Review. PubMed PMID: 26824699; PubMed Central PMCID: PMC4732945.
  • Ye L, Yang Y, Zhang X, Cai P, Li R, Chen D, Wei X, Zhang X, Xu H, Xiao J, Li X, Lin L, Zhang H. The Role of bFGF in the Excessive Activation of Astrocytes Is Related to the Inhibition of TLR4/NFκB Signals. Int J Mol Sci. 2015 Dec 28;17(1). pii: E37. doi: 10.3390/ijms17010037. PubMed PMID: 26729092; PubMed Central PMCID: PMC4730282.
  • Twaroski K, Mallanna SK, Jing R, DiFurio F, Urick A, Duncan SA. FGF2 mediates hepatic progenitor cell formation during human pluripotent stem cell differentiation by inducing the WNT antagonist NKD1. Genes Dev. 2015 Dec 1;29(23):2463-74. doi: 10.1101/gad.268961.115. PubMed PMID: 26637527; PubMed Central PMCID: PMC4691950.
  • Lim S, Cho H, Lee E, Won Y, Kim C, Ahn W, Lee E, Son Y. Osteogenic stimulation of human adipose-derived stem cells by pre-treatment with fibroblast growth factor 2. Cell Tissue Res. 2016 Apr;364(1):137-47. doi: 10.1007/s00441-015-2311-8. Epub 2015 Nov 7. PubMed PMID: 26547859.
  • Chen Y, Zhu G, Wu K, Gao Y, Zeng J, Shi Q, Guo P, Wang X, Chang LS, Li L, He D. FGF2-mediated reciprocal tumor cell-endothelial cell interplay contributes to the growth of chemoresistant cells: a potential mechanism for superficial bladder cancer recurrence. Tumour Biol. 2016 Apr;37(4):4313-21. doi: 10.1007/s13277-015-4214-4. Epub 2015 Oct 22. PubMed PMID: 26493998.
  • Zhao W, Yu H, Han Z, Gao N, Xue J, Wang Y. Clinical significance of joint detection of serum CEA, SCCA, and bFGF in the diagnosis of lung cancer. Int J Clin Exp Pathol. 2015 Aug 1;8(8):9506-11. eCollection 2015. PubMed PMID: 26464712; PubMed Central PMCID: PMC4583944.
  • Litwin M, Radwańska A, Paprocka M, Kieda C, Dobosz T, Witkiewicz W, Baczyńska D. The role of FGF2 in migration and tubulogenesis of endothelial progenitor cells in relation to pro-angiogenic Growth Factor proteins production. Mol Cell Biochem. 2015 Dec;410(1-2):131-42. doi: 10.1007/s11010-015-2545-5. Epub 2015 Aug 28. PubMed PMID: 26314253.
  • Fessler E, Borovski T, Medema JP. Endothelial cells induce cancer stem cell features in differentiated glioblastoma cells via bFGF. Mol Cancer. 2015 Aug 19;14:157. doi: 10.1186/s12943-015-0420-3. PubMed PMID: 26282129; PubMed Central PMCID: PMC4539660.
  • Jerebtsova M, Das JR, Tang P, Wong E, Ray PE. Angiopoietin-1 prevents severe bleeding complications induced by heparin-like drugs and fibroblast growth factor-2 in mice. Am J Physiol Heart Circ Physiol. 2015 Oct;309(8):H1314-25. doi: 10.1152/ajpheart.00373.2015. Epub 2015 Aug 14. PubMed PMID: 26276817; PubMed Central PMCID: PMC4666966.
  • Hurley MM, Adams DJ, Wang L, Jiang X, Burt PM, Du E, Xiao L. Accelerated fracture healing in transgenic mice overexpressing an anabolic isoform of fibroblast Growth Factor proteins 2. J Cell Biochem. 2016 Mar;117(3):599-611. doi: 10.1002/jcb.25308. PubMed PMID: 26252425.
  • Li S, Payne S, Wang F, Claus P, Su Z, Groth J, Geradts J, de Ridder G, Alvarez R, Marcom PK, Pizzo SV, Bachelder RE. Nuclear basic fibroblast growth factor regulates triple-negative breast cancer chemo-resistance. Breast Cancer Res. 2015 Jul 4;17:91. doi: 10.1186/s13058-015-0590-3. PubMed PMID: 26141457; PubMed Central PMCID: PMC4491247.

There are no reviews yet.

Be the first to review “Human FGF2b Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products