Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Efa_120 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P78417
Molecular weight:
26,79 kDa

Original price was: €311.00.Current price is: €259.00.

50ug 17% OFF + 259 loyalty points
Partial Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Efa_120 Recombinant Protein

Product name Human Efa_120 Recombinant Protein
Uniprot ID P78417
Uniprot link http://www.uniprot.org/uniprot/P78417
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLPRVNSGLRCATMSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKN KPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKED YAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTV
Molecular weight 26,79 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession CAD97673.1
Spec:Entrez GeneID 9446
Spec:NCBI Gene Aliases SPG-R, GSTO 1-1, GSTTLp28, P28, HEL-S-21
Spec:SwissProtID P78417
NCBI Reference CAD97673.1
Aliases /Synonyms Efa_120, hypothetical protein, Glutathione S-transferase omega-1, GSTO1, GSTO-1, Glutathione S-transferase omega 1-1, GSTO 1-1, Glutathione-dependent dehydroascorbate reductase, Monomethylarsonic acid reductase, MMA(V) reductase, S-(Phenacyl)glutathione reductase, SPG-R
Reference PX-P1085
Note For research use only
Molecular Constructor
Partial Yes
Product name Human Efa_120 Recombinant Protein
Uniprot ID P78417
Uniprot link http://www.uniprot.org/uniprot/P78417
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLPRVNSGLRCATMSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKN KPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKED YAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTV
Molecular weight 26,79 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession CAD97673.1
Spec:Entrez GeneID 9446
Spec:NCBI Gene Aliases SPG-R, GSTO 1-1, GSTTLp28, P28, HEL-S-21
Spec:SwissProtID P78417
NCBI Reference CAD97673.1
Aliases /Synonyms Efa_120, hypothetical protein, Glutathione S-transferase omega-1, GSTO1, GSTO-1, Glutathione S-transferase omega 1-1, GSTO 1-1, Glutathione-dependent dehydroascorbate reductase, Monomethylarsonic acid reductase, MMA(V) reductase, S-(Phenacyl)glutathione reductase, SPG-R
Reference PX-P1085
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P1085-1MG
Uniprot ID P78417
Uniprot link http://www.uniprot.org/uniprot/P78417
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLPRVNSGLRCATMSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKN KPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKED YAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTV
Molecular weight 26,79 kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession CAD97673.1
Spec:Entrez GeneID 9446
Spec:NCBI Gene Aliases SPG-R, GSTO 1-1, GSTTLp28, P28, HEL-S-21
Spec:SwissProtID P78417
NCBI Reference CAD97673.1
Aliases /Synonyms Efa_120, hypothetical protein, Glutathione S-transferase omega-1, GSTO1, GSTO-1, Glutathione S-transferase omega 1-1, GSTO 1-1, Glutathione-dependent dehydroascorbate reductase, Monomethylarsonic acid reductase, MMA(V) reductase, S-(Phenacyl)glutathione reductase, SPG-R
Reference PX-P1085
Note For research use only
Molecular Constructor
Partial Yes

Human Efa_120 Recombinant Protein

There are no reviews yet.

Be the first to review “Human Efa_120 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products