Brand: ProteoGenix

Human CLEC2D/OCIL/LLT1 Monoclonal Antibody

ARO-A16097-100
Quality Chart

Original price was: €439.00.Current price is: €330.00.

100ug 25% OFF + 330 loyalty points

Size Size

50ug Original price was: €289.00.Current price is: €231.00.
100ug Original price was: €439.00.Current price is: €330.00.
1MG Original price was: €1,321.00.Current price is: €957.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Human CLEC2D/OCIL/LLT1 Monoclonal Antibody

Product name	ARO-A16097-100
Uniprot ID	Q9UHP7
Uniprot link	Q9UHP7
Raw Antigen Sequence	MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGAGECAYLNDKGASSARHYTERKWICSKSDIHV
Form	Liquid in PBS buffer, pH 7.4
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mouse
Reactivity	Human
Aliases /Synonyms	CLAX, C-type lectin domain family 2 member D, Osteoclast inhibitory lectin, CLEC2D, Lectin-like transcript 1, Lectin-like NK cell receptor, OCIL, LLT-1, LLT1
Reference	ARO-A16097
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	CLEC2D/OCIL/LLT1
Clone Name	SAA0110
Protein Name	CLEC2D/OCIL/LLT1
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A16097-1MG
Uniprot ID	Q9UHP7
Uniprot link	Q9UHP7
Raw Antigen Sequence	MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGAGECAYLNDKGASSARHYTERKWICSKSDIHV
Form	Liquid in PBS buffer, pH 7.4
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mouse
Reactivity	Human
Aliases /Synonyms	CLAX, C-type lectin domain family 2 member D, Osteoclast inhibitory lectin, CLEC2D, Lectin-like transcript 1, Lectin-like NK cell receptor, OCIL, LLT-1, LLT1
Reference	ARO-A16097
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	CLEC2D/OCIL/LLT1
Clone Name	SAA0110
Protein Name	CLEC2D/OCIL/LLT1
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A16097-50
Uniprot ID	Q9UHP7
Uniprot link	Q9UHP7
Raw Antigen Sequence	MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGAGECAYLNDKGASSARHYTERKWICSKSDIHV
Form	Liquid in PBS buffer, pH 7.4
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mouse
Reactivity	Human
Aliases /Synonyms	CLAX, C-type lectin domain family 2 member D, Osteoclast inhibitory lectin, CLEC2D, Lectin-like transcript 1, Lectin-like NK cell receptor, OCIL, LLT-1, LLT1
Reference	ARO-A16097
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	CLEC2D/OCIL/LLT1
Clone Name	SAA0110
Protein Name	CLEC2D/OCIL/LLT1
Target species	Anti-Human Monoclonal Antibody