Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CGA Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P01215
Molecular weight:
13.11 kDa

Original price was: €410.00.Current price is: €325.00.

100ug 21% OFF + 325 loyalty points
Ala25–Ser116 His
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CGA Recombinant Protein, C-His

Human CGA Recombinant Protein, C-His

Product name ARO-P20354-100
Uniprot ID P01215
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Molecular weight 13.11 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala25-Ser116
Aliases /Synonyms Anterior pituitary glycoprotein hormones common subunit alpha, CG-alpha, CGA, Choriogonadotropin alpha chain, Chorionic gonadotrophin subunit alpha, FSH-alpha, Follicle-stimulating hormone alpha chain, Follitropin alpha chain, Glycoprotein hormones alpha chain, LSH-alpha, Luteinizing hormone alpha chain, Lutropin alpha chain, TSH-alpha, Thyroid-stimulating hormone alpha chain, Thyrotropin alpha chain
Reference ARO-P20354
Note For research use only.
Molecular Constructor
Ala25–Ser116 His
Product name ARO-P20354-1MG
Uniprot ID P01215
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Molecular weight 13.11 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala25-Ser116
Aliases /Synonyms Anterior pituitary glycoprotein hormones common subunit alpha, CG-alpha, CGA, Choriogonadotropin alpha chain, Chorionic gonadotrophin subunit alpha, FSH-alpha, Follicle-stimulating hormone alpha chain, Follitropin alpha chain, Glycoprotein hormones alpha chain, LSH-alpha, Luteinizing hormone alpha chain, Lutropin alpha chain, TSH-alpha, Thyroid-stimulating hormone alpha chain, Thyrotropin alpha chain
Reference ARO-P20354
Note For research use only.
Molecular Constructor
Ala25–Ser116 His
Product name ARO-P20354-50
Uniprot ID P01215
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Molecular weight 13.11 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala25-Ser116
Aliases /Synonyms Anterior pituitary glycoprotein hormones common subunit alpha, CG-alpha, CGA, Choriogonadotropin alpha chain, Chorionic gonadotrophin subunit alpha, FSH-alpha, Follicle-stimulating hormone alpha chain, Follitropin alpha chain, Glycoprotein hormones alpha chain, LSH-alpha, Luteinizing hormone alpha chain, Lutropin alpha chain, TSH-alpha, Thyroid-stimulating hormone alpha chain, Thyrotropin alpha chain
Reference ARO-P20354
Note For research use only.
Molecular Constructor
Ala25–Ser116 His

There are no reviews yet.

Be the first to review “Human CGA Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products