Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human CGA VHH (SAA1210)

Note:
For research use only. Not suitable for human use.

Original price was: €464.00.Current price is: €380.00.

100ug 18% OFF + 380 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Human CGA VHH (SAA1210)

Anti-Human CGA VHH (SAA1210)

Product name ARO-A16491-100
Uniprot ID P01215
Raw Antigen Sequence MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Follicle-stimulating hormone alpha chain, anti-Lutropin alpha chain, anti-Thyrotropin alpha chain, anti-Follitropin alpha chain, anti-Luteinizing hormone alpha chain, anti-Thyroid-stimulating hormone alpha chain, anti-FSH-alpha, anti-LSH-alpha, anti-Glycoprotein hormones alpha chain, anti-CGA, anti-TSH-alpha, anti-Choriogonadotropin alpha chain, anti-Anterior pituitary glycoprotein hormones common subunit alpha, anti-CG-alpha, anti-Chorionic gonadotrophin subunit alpha
Reference ARO-A16491
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CGA
Clone Name SAA1210
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16491-1MG
Uniprot ID P01215
Raw Antigen Sequence MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Follicle-stimulating hormone alpha chain, anti-Lutropin alpha chain, anti-Thyrotropin alpha chain, anti-Follitropin alpha chain, anti-Luteinizing hormone alpha chain, anti-Thyroid-stimulating hormone alpha chain, anti-FSH-alpha, anti-LSH-alpha, anti-Glycoprotein hormones alpha chain, anti-CGA, anti-TSH-alpha, anti-Choriogonadotropin alpha chain, anti-Anterior pituitary glycoprotein hormones common subunit alpha, anti-CG-alpha, anti-Chorionic gonadotrophin subunit alpha
Reference ARO-A16491
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CGA
Clone Name SAA1210
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16491-50
Uniprot ID P01215
Raw Antigen Sequence MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Follicle-stimulating hormone alpha chain, anti-Lutropin alpha chain, anti-Thyrotropin alpha chain, anti-Follitropin alpha chain, anti-Luteinizing hormone alpha chain, anti-Thyroid-stimulating hormone alpha chain, anti-FSH-alpha, anti-LSH-alpha, anti-Glycoprotein hormones alpha chain, anti-CGA, anti-TSH-alpha, anti-Choriogonadotropin alpha chain, anti-Anterior pituitary glycoprotein hormones common subunit alpha, anti-CG-alpha, anti-Chorionic gonadotrophin subunit alpha
Reference ARO-A16491
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CGA
Clone Name SAA1210
Target species Anti-Human Monoclonal Antibody

Anti-Human CGA VHH (SAA1210)

There are no reviews yet.

Be the first to review “Anti-Human CGA VHH (SAA1210)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products