Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD9 Monoclonal Antibody

  • ARO-A15797-50
  • Validated WB

Original price was: €340.00.Current price is: €274.00.

50ug 19% OFF + 274 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD9 Monoclonal Antibody

Product name ARO-A15797-100
Uniprot ID P21926
Uniprot link P21926
Raw Antigen Sequence MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Motility-related protein, Leukocyte antigen MIC3, TSPAN29, Cell growth-inhibiting gene 2 protein, CD9, MIC3, p24, Tspan-29, MRP-1, 5H9 antigen, Tetraspanin-29, CD9 antigen
Reference ARO-A15797
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD9
Clone Name SAA0003
Protein Name CD9
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15797-1MG
Uniprot ID P21926
Uniprot link P21926
Raw Antigen Sequence MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Motility-related protein, Leukocyte antigen MIC3, TSPAN29, Cell growth-inhibiting gene 2 protein, CD9, MIC3, p24, Tspan-29, MRP-1, 5H9 antigen, Tetraspanin-29, CD9 antigen
Reference ARO-A15797
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD9
Clone Name SAA0003
Protein Name CD9
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15797-50
Uniprot ID P21926
Uniprot link P21926
Raw Antigen Sequence MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Motility-related protein, Leukocyte antigen MIC3, TSPAN29, Cell growth-inhibiting gene 2 protein, CD9, MIC3, p24, Tspan-29, MRP-1, 5H9 antigen, Tetraspanin-29, CD9 antigen
Reference ARO-A15797
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD9
Clone Name SAA0003
Protein Name CD9
Target species Anti-Human Monoclonal Antibody

Human CD9 Monoclonal Antibody binds to Human CD9 Recombinant Protein, N-GST in WB Assay

Human CD9 Monoclonal Antibody binds to Human CD9 Recombinant Protein, N-GST in WB Assay

Human CD9 Recombinant Protein, N-GST(cat. No.ARO-P21316) can bind Human CD9 Monoclonal Antibody in Western Blot Assay as detected on gel analysis.

Human CD9 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD9 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products