Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD87/PLAUR/uPAR Monoclonal Antibody

  • ARO-A15785-50
  • Validated ELISA

Original price was: €314.00.Current price is: €231.00.

50ug 26% OFF + 231 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD87/PLAUR/uPAR Monoclonal Antibody

Product name ARO-A15785-100
Uniprot ID Q03405
Uniprot link Q03405
Raw Antigen Sequence MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms MO3, Urokinase plasminogen activator surface receptor, uPAR, UPAR, CD87, PLAUR, U-PAR, Monocyte activation antigen Mo3
Reference ARO-A15785
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD87/PLAUR/uPAR
Clone Name ATN-658
Protein Name CD87/PLAUR/uPAR
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15785-1MG
Uniprot ID Q03405
Uniprot link Q03405
Raw Antigen Sequence MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms MO3, Urokinase plasminogen activator surface receptor, uPAR, UPAR, CD87, PLAUR, U-PAR, Monocyte activation antigen Mo3
Reference ARO-A15785
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD87/PLAUR/uPAR
Clone Name ATN-658
Protein Name CD87/PLAUR/uPAR
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15785-50
Uniprot ID Q03405
Uniprot link Q03405
Raw Antigen Sequence MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms MO3, Urokinase plasminogen activator surface receptor, uPAR, UPAR, CD87, PLAUR, U-PAR, Monocyte activation antigen Mo3
Reference ARO-A15785
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD87/PLAUR/uPAR
Clone Name ATN-658
Protein Name CD87/PLAUR/uPAR
Target species Anti-Human Monoclonal Antibody

SEC-HPLC of Human CD87/PLAUR/uPAR Monoclonal Antibody

SEC-HPLC of Human CD87/PLAUR/uPAR Monoclonal Antibody

Human CD87/PLAUR/uPAR Monoclonal Antibodywas analyzed by size exclusion chromatography with UV detection.

Human CD87/PLAUR/uPAR Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD87/PLAUR/uPAR Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products