Brand: ProteoGenix

Human CD85b/LILRA6 Recombinant Protein, C-Fc

ARO-P20818-50
Quality Chart

Host species:: Mammalian cells
Origin species:: Human
Uniprot ID:: Q6PI73
Molecular weight:: 75.09 kDa

Original price was: €255.00.Current price is: €228.00.

50ug 11% OFF + 228 loyalty points

Met1–Asn447 Fc

Size Size

50ug Original price was: €255.00.Current price is: €228.00.
100ug Original price was: €377.00.Current price is: €325.00.
1MG Original price was: €1,084.00.Current price is: €943.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Human CD85b/LILRA6 Recombinant Protein, C-Fc

Product name	ARO-P20818-100
Uniprot ID	Q6PI73
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVEN
Molecular weight	75.09 kDa
Protein delivered with Tag?	C-Terminal Fc Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1-Asn447
Aliases /Synonyms	ILT-8, ILT8, Immunoglobulin-like transcript 8, LILRA6, Leukocyte Ig-like receptor, Leukocyte immunoglobulin-like receptor subfamily A member 6
Reference	ARO-P20818
Note	For research use only.
Molecular Constructor	Met1–Asn447 Fc

Product name	ARO-P20818-1MG
Uniprot ID	Q6PI73
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVEN
Molecular weight	75.09 kDa
Protein delivered with Tag?	C-Terminal Fc Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1-Asn447
Aliases /Synonyms	ILT-8, ILT8, Immunoglobulin-like transcript 8, LILRA6, Leukocyte Ig-like receptor, Leukocyte immunoglobulin-like receptor subfamily A member 6
Reference	ARO-P20818
Note	For research use only.
Molecular Constructor	Met1–Asn447 Fc

Product name	ARO-P20818-50
Uniprot ID	Q6PI73
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVEN
Molecular weight	75.09 kDa
Protein delivered with Tag?	C-Terminal Fc Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1-Asn447
Aliases /Synonyms	ILT-8, ILT8, Immunoglobulin-like transcript 8, LILRA6, Leukocyte Ig-like receptor, Leukocyte immunoglobulin-like receptor subfamily A member 6
Reference	ARO-P20818
Note	For research use only.
Molecular Constructor	Met1–Asn447 Fc