Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human TGFBR1 recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P36897
Molecular weight:
38.42 kDa

Original price was: €435.00.Current price is: €395.00.

100ug 9% OFF + 395 loyalty points
Leu34–Leu126 Fc
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human TGFBR1 recombinant protein

Human TGFBR1 recombinant protein

Product name PX-P6523-100
Uniprot ID P36897
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVEL
Molecular weight 38.42 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu34-Leu126
Aliases /Synonyms ALK-5, TGFBR1, TGFR-1, ALK5, Transforming growth factor-beta receptor type I, TGF-beta type I receptor, TbetaR-I, SKR4, Activin A receptor type II-like protein kinase of 53kD, TGF-beta receptor type I, TGF-beta receptor type-1, Serine/threonine-protein kinase receptor R4Activin receptor-like kinase 5,
Reference PX-P6523
Molecular Constructor
Leu34–Leu126 Fc
Product name PX-P6523-1MG
Uniprot ID P36897
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVEL
Molecular weight 38.42 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu34-Leu126
Aliases /Synonyms ALK-5, TGFBR1, TGFR-1, ALK5, Transforming growth factor-beta receptor type I, TGF-beta type I receptor, TbetaR-I, SKR4, Activin A receptor type II-like protein kinase of 53kD, TGF-beta receptor type I, TGF-beta receptor type-1, Serine/threonine-protein kinase receptor R4Activin receptor-like kinase 5,
Reference PX-P6523
Molecular Constructor
Leu34–Leu126 Fc
Product name PX-P6523-50
Uniprot ID P36897
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVEL
Molecular weight 38.42 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu34-Leu126
Aliases /Synonyms ALK-5, TGFBR1, TGFR-1, ALK5, Transforming growth factor-beta receptor type I, TGF-beta type I receptor, TbetaR-I, SKR4, Activin A receptor type II-like protein kinase of 53kD, TGF-beta receptor type I, TGF-beta receptor type-1, Serine/threonine-protein kinase receptor R4Activin receptor-like kinase 5,
Reference PX-P6523
Molecular Constructor
Leu34–Leu126 Fc

There are no reviews yet.

Be the first to review “Human TGFBR1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products