Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD7 (3A1e) Monoclonal Antibody

  • ARO-A15766-50
  • Validated ELISA FC

Original price was: €343.00.Current price is: €274.00.

50ug 20% OFF + 274 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD7 (3A1e) Monoclonal Antibody

Product name ARO-A15766-100
Uniprot ID P09564
Uniprot link P09564
Raw Antigen Sequence MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms GP40, CD7, T-cell surface antigen Leu-9, T-cell leukemia antigen, TP41, T-cell antigen CD7
Reference ARO-A15766
Isotype IgG2b, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD7 (3A1e)
Clone Name 3A1e
Protein Name CD7 (3A1e)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15766-1MG
Uniprot ID P09564
Uniprot link P09564
Raw Antigen Sequence MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms GP40, CD7, T-cell surface antigen Leu-9, T-cell leukemia antigen, TP41, T-cell antigen CD7
Reference ARO-A15766
Isotype IgG2b, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD7 (3A1e)
Clone Name 3A1e
Protein Name CD7 (3A1e)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15766-50
Uniprot ID P09564
Uniprot link P09564
Raw Antigen Sequence MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms GP40, CD7, T-cell surface antigen Leu-9, T-cell leukemia antigen, TP41, T-cell antigen CD7
Reference ARO-A15766
Isotype IgG2b, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD7 (3A1e)
Clone Name 3A1e
Protein Name CD7 (3A1e)
Target species Anti-Human Monoclonal Antibody

Flow Cytometry results for Human CD7 (3A1e) Monoclonal Antibody

Flow Cytometry results for Human CD7 (3A1e) Monoclonal Antibody

Flow-cytometry using anti-human CD7 antibody. Human Jurkat cell line were stained with an irrelevant antibody (Green Histogram) or an anti-human CD7 antibody monoclonal antibody (Catalog # ARO-A15766 , Red Histogram) at a concentration of 5µg/ml for 30 mins at RT. After washing, bound antibody was detected using a CoraLite488 conjugated goat anti-mouse antibody (Catalog # PTX17816) and cells analysed on a NovoCyte Flow Cytometer.

Human CD7 (3A1e) Monoclonal Antibody binds to Recombinant Mouse CD7 Protein, N-GST & C-His in ELISA Assay

Human CD7 (3A1e) Monoclonal Antibody binds to Recombinant Mouse CD7 Protein, N-GST & C-His in ELISA Assay

Recombinant Mouse CD7 Protein, N-GST & C-His(cat. No.ARO-P10972) at 0.5µg/mL (100µL/well) can bind Human CD7 (3A1e) Monoclonal Antibody in indirect ELISA with Goat secondary antibody measured by OD450.

Human CD7 (3A1e) Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD7 (3A1e) Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products