Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD66b/CEACAM8 Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P31997

Original price was: €258.00.Current price is: €228.00.

50ug 12% OFF + 228 loyalty points
Met1–Ser319 Fc
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD66b/CEACAM8 Recombinant Protein, C-Fc

Product name ARO-P18161-100
Uniprot ID P31997
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser319
Aliases /Synonyms Cell adhesion molecule CEACAM8, CD67 antigen, Carcinoembryonic antigen CGM6, Carcinoembryonic antigen-related cell adhesion molecule 8, CEA cell adhesion molecule 8, Non-specific cross-reacting antigen NCA-95, CD66b, CEACAM8, CGM6
Reference ARO-P18161
Note For research use only.
Molecular Constructor
Met1–Ser319 Fc
Product name ARO-P18161-1MG
Uniprot ID P31997
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser319
Aliases /Synonyms Cell adhesion molecule CEACAM8, CD67 antigen, Carcinoembryonic antigen CGM6, Carcinoembryonic antigen-related cell adhesion molecule 8, CEA cell adhesion molecule 8, Non-specific cross-reacting antigen NCA-95, CD66b, CEACAM8, CGM6
Reference ARO-P18161
Note For research use only.
Molecular Constructor
Met1–Ser319 Fc
Product name ARO-P18161-50
Uniprot ID P31997
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser319
Aliases /Synonyms Cell adhesion molecule CEACAM8, CD67 antigen, Carcinoembryonic antigen CGM6, Carcinoembryonic antigen-related cell adhesion molecule 8, CEA cell adhesion molecule 8, Non-specific cross-reacting antigen NCA-95, CD66b, CEACAM8, CGM6
Reference ARO-P18161
Note For research use only.
Molecular Constructor
Met1–Ser319 Fc

SDS-PAGE for Human CD66b/CEACAM8 Recombinant Protein, C-Fc

SDS-PAGE for Human CD66b/CEACAM8 Recombinant Protein, C-Fc

Human CD66b/CEACAM8 Recombinant Protein, C-Fc, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Human CD66b/CEACAM8 Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products